SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6W854 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6W854
Domain Number 1 Region: 159-280
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000824
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6W854
Sequence length 394
Comment (tr|A0A0F6W854|A0A0F6W854_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AKF09830.1} KW=Complete proteome; Reference proteome OX=927083 OS=Sandaracinus amylolyticus. GN=DB32_006979 OC=Sorangiineae; Sandaracinaceae; Sandaracinus.
Sequence
MDLKTEAQEVIARLHDSVARDDLATARDCVLLASTLSENALALLPPADAPFAGVADAGEG
WVVYGVGTVERFGLGRGANVALLQLFRGRDGKLRLDASSFAVAEATSMAARDLAAAFQEH
AATEKRIPRSARPARAWSPPPASPTPISSIQWLGRPDAGVASSDVDAAERALGVTFPGGY
REYVTRFGAALECGLVRIYPPRRIIEELAEWRARVDAYWLWTTLELDRDRAQRCIVLGDT
TRGDEIVLDPQRPDALFVLPRHHDAIVCIPGDLTHALAWLCESGELAAPCHVRYAEPLEG
QAHRTYDPTSNEGDQDDWLADARATHDVLLALDPDAQSIAHDDDDGGWTVLLPSIGGTAF
VHANGAVSVSCDPEADLTRLDALLRDRGLELRTR
Download sequence
Identical sequences A0A0F6W854
WP_053236837.1.70751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]