SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6WCM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F6WCM0
Domain Number - Region: 16-59
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0131
Family N-utilization substance G protein NusG, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6WCM0
Sequence length 65
Comment (tr|A0A0F6WCM0|A0A0F6WCM0_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AKF13249.1} KW=Complete proteome OX=1647404 OS=Sinorhizobium phage phiM19. GN=PHIM19_344 OC=Tevenvirinae; T4virus.
Sequence
MNKRLEISVEFTDSIYFVPARYVQRWWKGEYTTTLEPAPIDGYMFLQEPNHDQWVAIRNS
QENLE
Download sequence
Identical sequences A0A0F6WBZ5 A0A0F6WCM0 A0A0F6YQ90 S5MDK4
YP_009143257.1.22249 YP_009212589.1.66919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]