SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7BQB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7BQB0
Domain Number 1 Region: 15-64
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000051
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7BQB0
Sequence length 543
Comment (tr|A0A0F7BQB0|A0A0F7BQB0_MYXFU) Uncharacterized protein {ECO:0000313|EMBL:AKF84064.1} KW=Complete proteome OX=1334629 OS=Myxococcus fulvus 124B02. GN=MFUL124B02_39970 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MHEWLEALRKSAKAASSGVSADEVRRAETECGVPFPEDLGHLYLTFDGGELHGDVSLFPL
HGPEGSVSVLEKTRLKLVGLPAAGVWRIGMKGPHRHLFSARKSAMVEQGDGGGPLPGWVD
ALGEEDWLYGTWDSEKREMRLYRSLKDMLDVLVPPAEVESFGERTFARAMNAVLQEALSG
MSGEEESEEEKVAESTEVEVEEEEEDTGAQRELAYEYDDDVSRGRRGGGQDESGGFGRFG
AKSGGGKKPVSRSSVTQVELFVRPTMQEALRKELGPETAKKPAAKSKASKPAATIVETVK
DAVAKPVAQVAEAVKDAVSKPVEKAAKATKAAVTKPVEAVKEAVAKPVEKAARATKSAAT
KLVDAAATATTKTVVKAVEVTQPKAKPAAQPVTQTSAVLPATKSPATSQPVAKTSAKATS
AATKPATAKSAAKSPAATAKSTTKQAAAKKSAGAKPTTKKSAAKKSAAKSVGKQPAAKKS
AGKIASKKVAASKPAKKPAGAKPTKSAAKKSTGTKPARKSAPSKAPAKKSSAKSASKKPK
SKR
Download sequence
Identical sequences A0A0F7BQB0
WP_046716713.1.90154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]