SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7E4C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7E4C3
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000942
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7E4C3
Sequence length 152
Comment (tr|A0A0F7E4C3|A0A0F7E4C3_MYXFU) Uncharacterized protein {ECO:0000313|EMBL:AKF84229.1} KW=Complete proteome OX=1334629 OS=Myxococcus fulvus 124B02. GN=MFUL124B02_41180 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MTLEHLLNEVSRAHYPRPPASAREISEFEALVGWQLDDELRAFYRHCNGAELFKPLPDSN
YSILSLTDVLRACVRVRRRDGGSPETASFFPLVDCQDSDWVLVDVAQPGGPYPLLDAYHE
SYPRVVQRVAGSFREFLERALASEGQLYWLRE
Download sequence
Identical sequences A0A0F7E4C3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]