SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7E4V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7E4V0
Domain Number 1 Region: 158-214
Classification Level Classification E-value
Superfamily NTF2-like 0.0000383
Family Ketosteroid isomerase-like 0.082
Further Details:      
 
Domain Number 2 Region: 63-197
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000824
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7E4V0
Sequence length 220
Comment (tr|A0A0F7E4V0|A0A0F7E4V0_MYXFU) Uncharacterized protein {ECO:0000313|EMBL:AKF85148.1} KW=Complete proteome OX=1334629 OS=Myxococcus fulvus 124B02. GN=MFUL124B02_09940 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MASATWREDLKALLDEMDAWAQARGWRLIREAPLTREEVDALPRMLTGFEYELPTPYREE
AFVIPDSYREFLMLHREVRLEYRPDSGKWETYRPFHVWTPTMDSLTASWTPAGATVDERE
FTTTDLISFADAHMGAEASRWCFYTRTAPKDGELPVYFEDNDYEALAGHYVDDGTWLDES
DPMTFGFESFEHWFRALCKVLRREDVDPEDVRQVGNSIKK
Download sequence
Identical sequences A0A0F7E4V0
WP_046711809.1.90154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]