SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7EJ83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7EJ83
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-18
Family SMI1/KNR4-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7EJ83
Sequence length 193
Comment (tr|A0A0F7EJ83|A0A0F7EJ83_BRELA) Cell wall assembly protein {ECO:0000313|EMBL:AKF95998.1} OX=1465 OS=Brevibacillus laterosporus (Bacillus laterosporus). GN=EX87_20750 OC=Brevibacillus.
Sequence
MKKRIEELEQLLSSKVGEDVQEEYNNYLSLQGASEESLQEIETLFDIKLPEDFKEFYRYK
NGSGYHFHILYPEYSEGCIEPFYLYSLDEIIETKEYFCKDDELLSEYYDEQEISELDARI
KPYLFNKKWFPFAQLAGGSLYLMLDYDPAPGGRTGQIIAYVHDPDFIYYIASSFTELLSE
SNTNLQDWEEIDY
Download sequence
Identical sequences A0A0F7EJ83
WP_031415239.1.563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]