SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7F7J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7F7J6
Domain Number 1 Region: 140-284
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.06e-55
Family AadK C-terminal domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.81e-43
Family AadK N-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7F7J6
Sequence length 293
Comment (tr|A0A0F7F7J6|A0A0F7F7J6_PAEDU) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:AKG33338.1} KW=Complete proteome OX=1333534 OS=Paenibacillus durus ATCC 35681. GN=VK70_00860 OC=Paenibacillus.
Sequence
MRSEQEMFDLILGIAQKDERIRAVYMNGSRTNSNAPKDIFQDYDIVYIVTETASFINNEQ
WTTMFGDMLMMQEPDKNDQSTGIDMDFSRSYGYLMLFTDGNRIDLHIETKESMLTRYVSD
KLTLPLLDKDNCLPIIPPPTDIDYHVQKPTEPLFMGCCNDFWWCLQNVAKGIWRDELPYA
KQMFECVIRRRLDEMISWWVGTNYDFQVSIGKMGKYMKKYLPESYWDMYKETYSDSNDHH
MWNSVFTACELFRILAKEVAEHFQYTYEIKDDVNMTNYLRRVRELPVDAKGIF
Download sequence
Identical sequences A0A0F7F7J6
WP_025695800.1.27301 WP_025695800.1.31286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]