SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7FZF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7FZF2
Domain Number 1 Region: 52-177
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000837
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7FZF2
Sequence length 188
Comment (tr|A0A0F7FZF2|A0A0F7FZF2_9ACTN) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:AKG46208.1} KW=Complete proteome; Reference proteome OX=408015 OS=Streptomyces xiamenensis. GN=SXIM_48240 OC=Streptomyces.
Sequence
MTDGAESNVPPAPCPGTPQEWRAYLNEYSEWYLSSLDEDELGEVTQEQFDARWLGHDPAD
ERAIAATEERLGVALPPSLRAFLLASDGWGRVAEWIDSLRPCAEFAWFRDEHTGWASEDG
GEEDDVFRYGLSIARGEDVFLLDTSDVLENGEYRAYLLAVKYGELSDPCDSFSELLTVGR
EEIQELMD
Download sequence
Identical sequences A0A0F7FZF2
WP_046725092.1.26051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]