SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7H081 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7H081
Domain Number 1 Region: 38-236
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 1.57e-58
Family Chlorophyll a-b binding protein 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7H081
Sequence length 242
Comment (tr|A0A0F7H081|A0A0F7H081_9ASPA) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} OX=1390594 OS=Goodyera fumata. GN=LHCA1 OC=Orchidoideae; Cranichideae; Goodyerinae; Goodyera.
Sequence
MASVGLRSFAVVFPSLLSSSKSQFTSSFALSAGGHGSSRFSMSAEWMPGQPRPAHLDGTA
PGDFGFDPLGFGVVPENLERYKESELYHCRWAMAAIPGMLIPEALGLGNWVKAQAWATVP
GGQATYLGVPVPWGTLPTILIIEFLAISFVEHQRSMEKDIERKKYPGGAFDPLGFSKDPE
KLKDYKVKEVKNGRLAMLAFVGICVQQSAYPGTGPLENLAAHLADPWHKNIGDVIIPRSL
LP
Download sequence
Identical sequences A0A0F7H081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]