SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7HKT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7HKT5
Domain Number 1 Region: 26-90
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000176
Family Subtilase propeptides/inhibitors 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7HKT5
Sequence length 98
Comment (tr|A0A0F7HKT5|A0A0F7HKT5_9STAP) Uncharacterized protein {ECO:0000313|EMBL:AKG74558.1} KW=Complete proteome; Reference proteome OX=407035 OS=Salinicoccus halodurans. GN=AAT16_10370 OC=Salinicoccus.
Sequence
MKRILFLAGLFSLILLAGCDGMEEKKDYLVSVKEDFTEEELEALNIDEADIKHKFSFMDM
YLISLNESQVEKLEGHEKVNYVEADQEVSTPEPGDEEK
Download sequence
Identical sequences A0A0F7HKT5
WP_046790740.1.55599 WP_046790740.1.85398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]