SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7J4G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7J4G7
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.72e-75
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 202-335
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.25e-59
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7J4G7
Sequence length 335
Comment (tr|A0A0F7J4G7|A0A0F7J4G7_LAGLA) Oligoadenylate synthetase 1 {ECO:0000313|EMBL:AKH04308.1} OX=9519 OS=Lagothrix lagotricha (Brown woolly monkey) (Humboldt's woolly monkey). GN= OC=Platyrrhini; Atelidae; Atelinae; Lagothrix.
Sequence
MMDLRNTPARDLDKFIEDNLLPDTHFRMQINQAIDIICGFLKERCFRGSSYPVRVSKVVK
GGSSGKGTALRGRSDADLVVFLSPLTTFQDQLNHRGDFIREIRKQLEACQRERVFSVKFE
VQTSHWDSPRALSFVLSSPRLREGVEFDVLPAFDALGQLIGVYKPNPQIYVKLIEECIYL
QKEGEFSTCFTELQGNFLKQRPTKLKSLIRLVKHWYQNCKEKLGKPLPPQYTLELLTVYA
WEQGSMKTDFITAQGFRTVLELVINYQQLCIYWTVYYDFKNPNIREYLSRQLSKPRPVIL
DPADPTGNLGGDPKGWRKLAREAEAWLKYPCFKNW
Download sequence
Identical sequences A0A0F7J4G7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]