SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7JB55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F7JB55
Domain Number - Region: 61-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00251
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7JB55
Sequence length 222
Comment (tr|A0A0F7JB55|A0A0F7JB55_SALET) Putative cytoplasmic protein {ECO:0000313|EMBL:AKH08224.1} KW=Complete proteome OX=59201 OS=Salmonella enterica I. GN=CVR97_05180 OC=Enterobacteriaceae; Salmonella.
Sequence
MDISLTNLIELVKKVNRNKVPTPMSAEEISRLRVRKYRDPQNTETTELPESLKALLAYDR
DLLSNYNMPVIETLQKSIDNEGVIHSYSPDEEAYYGVGMDSSGIDIEDLMPVWSNDPRLP
ALIRIDHVGDQAIFIYITERDANGEYPIARMERNEFWLAESSLVEYLYNIISGAKDIGFT
EEDLHLPQWKAQQKMNEQRDAALLDLEDYHEAFWAKLDALVD
Download sequence
Identical sequences A0A0D6FAG6 A0A0F6B4U8 A0A0F7JB55 A0A0H3NED7 A0A0T9W6X8 A0A0W3LMX3 A0A2D3AES9 A0A2H9YDZ9 E8XGM5 Q8ZN44
NP_461469.1.58477 WP_000355342.1.100010 WP_000355342.1.100234 WP_000355342.1.100376 WP_000355342.1.100424 WP_000355342.1.100436 WP_000355342.1.100484 WP_000355342.1.100488 WP_000355342.1.100597 WP_000355342.1.10076 WP_000355342.1.100781 WP_000355342.1.100793 WP_000355342.1.100869 WP_000355342.1.100871 WP_000355342.1.100882 WP_000355342.1.101007 WP_000355342.1.101020 WP_000355342.1.101074 WP_000355342.1.101078 WP_000355342.1.101180 WP_000355342.1.101259 WP_000355342.1.101284 WP_000355342.1.101291 WP_000355342.1.101353 WP_000355342.1.101386 WP_000355342.1.101404 WP_000355342.1.101420 WP_000355342.1.101589 WP_000355342.1.101707 WP_000355342.1.101734 WP_000355342.1.101878 WP_000355342.1.101953 WP_000355342.1.10220 WP_000355342.1.10266 WP_000355342.1.10429 WP_000355342.1.10439 WP_000355342.1.10678 WP_000355342.1.10753 WP_000355342.1.10992 WP_000355342.1.11024 WP_000355342.1.11031 WP_000355342.1.11098 WP_000355342.1.11168 WP_000355342.1.11190 WP_000355342.1.11295 WP_000355342.1.11455 WP_000355342.1.11458 WP_000355342.1.11518 WP_000355342.1.11532 WP_000355342.1.11543 WP_000355342.1.11763 WP_000355342.1.11772 WP_000355342.1.11897 WP_000355342.1.12114 WP_000355342.1.12351 WP_000355342.1.12370 WP_000355342.1.12546 WP_000355342.1.1264 WP_000355342.1.12728 WP_000355342.1.12879 WP_000355342.1.12936 WP_000355342.1.12995 WP_000355342.1.13027 WP_000355342.1.13106 WP_000355342.1.13130 WP_000355342.1.13414 WP_000355342.1.13488 WP_000355342.1.13509 WP_000355342.1.13669 WP_000355342.1.13741 WP_000355342.1.1387 WP_000355342.1.13908 WP_000355342.1.13932 WP_000355342.1.13968 WP_000355342.1.14001 WP_000355342.1.14151 WP_000355342.1.14239 WP_000355342.1.14320 WP_000355342.1.14379 WP_000355342.1.14406 WP_000355342.1.14410 WP_000355342.1.14466 WP_000355342.1.14524 WP_000355342.1.14554 WP_000355342.1.14725 WP_000355342.1.14852 WP_000355342.1.1489 WP_000355342.1.14932 WP_000355342.1.15055 WP_000355342.1.15124 WP_000355342.1.15223 WP_000355342.1.15226 WP_000355342.1.15316 WP_000355342.1.1540 WP_000355342.1.15508 WP_000355342.1.15784 WP_000355342.1.15830 WP_000355342.1.16062 WP_000355342.1.16063 WP_000355342.1.16103 WP_000355342.1.16226 WP_000355342.1.16233 WP_000355342.1.16284 WP_000355342.1.16328 WP_000355342.1.1635 WP_000355342.1.16468 WP_000355342.1.16614 WP_000355342.1.16650 WP_000355342.1.16686 WP_000355342.1.16691 WP_000355342.1.16732 WP_000355342.1.16735 WP_000355342.1.16786 WP_000355342.1.16858 WP_000355342.1.16896 WP_000355342.1.16916 WP_000355342.1.16965 WP_000355342.1.1700 WP_000355342.1.17307 WP_000355342.1.174 WP_000355342.1.17480 WP_000355342.1.17546 WP_000355342.1.17702 WP_000355342.1.17705 WP_000355342.1.18019 WP_000355342.1.18111 WP_000355342.1.18163 WP_000355342.1.18265 WP_000355342.1.18267 WP_000355342.1.18468 WP_000355342.1.18607 WP_000355342.1.18705 WP_000355342.1.18715 WP_000355342.1.18776 WP_000355342.1.18822 WP_000355342.1.18881 WP_000355342.1.18940 WP_000355342.1.18949 WP_000355342.1.19053 WP_000355342.1.19320 WP_000355342.1.19458 WP_000355342.1.19460 WP_000355342.1.19461 WP_000355342.1.19614 WP_000355342.1.19706 WP_000355342.1.19724 WP_000355342.1.19749 WP_000355342.1.19784 WP_000355342.1.19802 WP_000355342.1.19809 WP_000355342.1.19867 WP_000355342.1.1998 WP_000355342.1.20 WP_000355342.1.2010 WP_000355342.1.20212 WP_000355342.1.20266 WP_000355342.1.20271 WP_000355342.1.20362 WP_000355342.1.20418 WP_000355342.1.20443 WP_000355342.1.20525 WP_000355342.1.2054 WP_000355342.1.20553 WP_000355342.1.20626 WP_000355342.1.20646 WP_000355342.1.20886 WP_000355342.1.21049 WP_000355342.1.21146 WP_000355342.1.21245 WP_000355342.1.21246 WP_000355342.1.21269 WP_000355342.1.21400 WP_000355342.1.21497 WP_000355342.1.21499 WP_000355342.1.21603 WP_000355342.1.21751 WP_000355342.1.21757 WP_000355342.1.22024 WP_000355342.1.2205 WP_000355342.1.22062 WP_000355342.1.22067 WP_000355342.1.2221 WP_000355342.1.2235 WP_000355342.1.22379 WP_000355342.1.22427 WP_000355342.1.2246 WP_000355342.1.22485 WP_000355342.1.22620 WP_000355342.1.22870 WP_000355342.1.22979 WP_000355342.1.23102 WP_000355342.1.23114 WP_000355342.1.2314 WP_000355342.1.23192 WP_000355342.1.23259 WP_000355342.1.23460 WP_000355342.1.23472 WP_000355342.1.23482 WP_000355342.1.23634 WP_000355342.1.2364 WP_000355342.1.23932 WP_000355342.1.24017 WP_000355342.1.24206 WP_000355342.1.24308 WP_000355342.1.24578 WP_000355342.1.24737 WP_000355342.1.24779 WP_000355342.1.25008 WP_000355342.1.25015 WP_000355342.1.25405 WP_000355342.1.25454 WP_000355342.1.25493 WP_000355342.1.25668 WP_000355342.1.25690 WP_000355342.1.2570 WP_000355342.1.25740 WP_000355342.1.25793 WP_000355342.1.25814 WP_000355342.1.25988 WP_000355342.1.26282 WP_000355342.1.26311 WP_000355342.1.26319 WP_000355342.1.26429 WP_000355342.1.26440 WP_000355342.1.26493 WP_000355342.1.26551 WP_000355342.1.26567 WP_000355342.1.27010 WP_000355342.1.27173 WP_000355342.1.27206 WP_000355342.1.27423 WP_000355342.1.27561 WP_000355342.1.2763 WP_000355342.1.27665 WP_000355342.1.27707 WP_000355342.1.27761 WP_000355342.1.2777 WP_000355342.1.27857 WP_000355342.1.27977 WP_000355342.1.28094 WP_000355342.1.28170 WP_000355342.1.28302 WP_000355342.1.2835 WP_000355342.1.28370 WP_000355342.1.28538 WP_000355342.1.28575 WP_000355342.1.28625 WP_000355342.1.28655 WP_000355342.1.28694 WP_000355342.1.2879 WP_000355342.1.2890 WP_000355342.1.28938 WP_000355342.1.28946 WP_000355342.1.29006 WP_000355342.1.29010 WP_000355342.1.2910 WP_000355342.1.29588 WP_000355342.1.29601 WP_000355342.1.29606 WP_000355342.1.29615 WP_000355342.1.29619 WP_000355342.1.29704 WP_000355342.1.29969 WP_000355342.1.30006 WP_000355342.1.30027 WP_000355342.1.30180 WP_000355342.1.30469 WP_000355342.1.30505 WP_000355342.1.30507 WP_000355342.1.30535 WP_000355342.1.30547 WP_000355342.1.30794 WP_000355342.1.30833 WP_000355342.1.30835 WP_000355342.1.30972 WP_000355342.1.31 WP_000355342.1.3113 WP_000355342.1.31185 WP_000355342.1.3119 WP_000355342.1.31190 WP_000355342.1.31195 WP_000355342.1.31196 WP_000355342.1.31281 WP_000355342.1.31362 WP_000355342.1.31504 WP_000355342.1.31515 WP_000355342.1.31578 WP_000355342.1.31658 WP_000355342.1.31940 WP_000355342.1.31967 WP_000355342.1.31972 WP_000355342.1.32192 WP_000355342.1.32206 WP_000355342.1.32438 WP_000355342.1.32515 WP_000355342.1.32660 WP_000355342.1.32702 WP_000355342.1.32714 WP_000355342.1.32786 WP_000355342.1.32804 WP_000355342.1.32907 WP_000355342.1.33030 WP_000355342.1.33127 WP_000355342.1.33143 WP_000355342.1.33248 WP_000355342.1.333 WP_000355342.1.33492 WP_000355342.1.33553 WP_000355342.1.33592 WP_000355342.1.33894 WP_000355342.1.34043 WP_000355342.1.34075 WP_000355342.1.34257 WP_000355342.1.34279 WP_000355342.1.34319 WP_000355342.1.34453 WP_000355342.1.34610 WP_000355342.1.34856 WP_000355342.1.34975 WP_000355342.1.35129 WP_000355342.1.35184 WP_000355342.1.35404 WP_000355342.1.35408 WP_000355342.1.35425 WP_000355342.1.35446 WP_000355342.1.35463 WP_000355342.1.35503 WP_000355342.1.35509 WP_000355342.1.35590 WP_000355342.1.35940 WP_000355342.1.36003 WP_000355342.1.3601 WP_000355342.1.36609 WP_000355342.1.36690 WP_000355342.1.3670 WP_000355342.1.36705 WP_000355342.1.36918 WP_000355342.1.36931 WP_000355342.1.37073 WP_000355342.1.37111 WP_000355342.1.37112 WP_000355342.1.37256 WP_000355342.1.37293 WP_000355342.1.37370 WP_000355342.1.37376 WP_000355342.1.3744 WP_000355342.1.37498 WP_000355342.1.37504 WP_000355342.1.37618 WP_000355342.1.37968 WP_000355342.1.37978 WP_000355342.1.38125 WP_000355342.1.38145 WP_000355342.1.383 WP_000355342.1.3848 WP_000355342.1.38613 WP_000355342.1.38673 WP_000355342.1.38693 WP_000355342.1.38773 WP_000355342.1.38882 WP_000355342.1.38913 WP_000355342.1.39003 WP_000355342.1.39136 WP_000355342.1.39197 WP_000355342.1.39229 WP_000355342.1.39385 WP_000355342.1.39405 WP_000355342.1.39420 WP_000355342.1.39449 WP_000355342.1.39512 WP_000355342.1.39629 WP_000355342.1.39763 WP_000355342.1.39862 WP_000355342.1.39921 WP_000355342.1.39923 WP_000355342.1.40017 WP_000355342.1.40072 WP_000355342.1.40073 WP_000355342.1.4011 WP_000355342.1.40208 WP_000355342.1.40240 WP_000355342.1.40257 WP_000355342.1.40292 WP_000355342.1.40305 WP_000355342.1.40311 WP_000355342.1.40380 WP_000355342.1.40395 WP_000355342.1.40465 WP_000355342.1.40710 WP_000355342.1.4075 WP_000355342.1.4087 WP_000355342.1.40877 WP_000355342.1.41017 WP_000355342.1.41086 WP_000355342.1.41091 WP_000355342.1.41226 WP_000355342.1.41279 WP_000355342.1.41516 WP_000355342.1.41554 WP_000355342.1.41572 WP_000355342.1.41591 WP_000355342.1.41662 WP_000355342.1.41708 WP_000355342.1.41761 WP_000355342.1.41882 WP_000355342.1.41979 WP_000355342.1.41985 WP_000355342.1.42104 WP_000355342.1.42320 WP_000355342.1.42342 WP_000355342.1.42422 WP_000355342.1.4276 WP_000355342.1.42864 WP_000355342.1.4288 WP_000355342.1.43018 WP_000355342.1.43041 WP_000355342.1.43244 WP_000355342.1.43312 WP_000355342.1.43334 WP_000355342.1.43437 WP_000355342.1.43522 WP_000355342.1.43613 WP_000355342.1.43668 WP_000355342.1.43886 WP_000355342.1.44005 WP_000355342.1.44043 WP_000355342.1.44099 WP_000355342.1.44121 WP_000355342.1.44291 WP_000355342.1.44310 WP_000355342.1.44386 WP_000355342.1.44479 WP_000355342.1.44640 WP_000355342.1.4467 WP_000355342.1.44747 WP_000355342.1.4485 WP_000355342.1.44877 WP_000355342.1.44927 WP_000355342.1.45067 WP_000355342.1.45074 WP_000355342.1.45079 WP_000355342.1.45098 WP_000355342.1.45177 WP_000355342.1.45184 WP_000355342.1.45259 WP_000355342.1.45349 WP_000355342.1.45365 WP_000355342.1.45550 WP_000355342.1.45585 WP_000355342.1.45660 WP_000355342.1.45690 WP_000355342.1.458 WP_000355342.1.46011 WP_000355342.1.46069 WP_000355342.1.46112 WP_000355342.1.46173 WP_000355342.1.46174 WP_000355342.1.46187 WP_000355342.1.46303 WP_000355342.1.46595 WP_000355342.1.46675 WP_000355342.1.47057 WP_000355342.1.47214 WP_000355342.1.47429 WP_000355342.1.47448 WP_000355342.1.4747 WP_000355342.1.47472 WP_000355342.1.47478 WP_000355342.1.47621 WP_000355342.1.47799 WP_000355342.1.48242 WP_000355342.1.48253 WP_000355342.1.483 WP_000355342.1.48367 WP_000355342.1.48377 WP_000355342.1.4853 WP_000355342.1.48788 WP_000355342.1.4885 WP_000355342.1.48876 WP_000355342.1.48894 WP_000355342.1.48919 WP_000355342.1.49084 WP_000355342.1.49155 WP_000355342.1.49204 WP_000355342.1.49239 WP_000355342.1.49256 WP_000355342.1.49290 WP_000355342.1.49340 WP_000355342.1.49366 WP_000355342.1.49490 WP_000355342.1.49515 WP_000355342.1.49572 WP_000355342.1.4979 WP_000355342.1.49803 WP_000355342.1.49805 WP_000355342.1.49929 WP_000355342.1.50080 WP_000355342.1.50161 WP_000355342.1.50211 WP_000355342.1.50376 WP_000355342.1.50389 WP_000355342.1.50676 WP_000355342.1.50804 WP_000355342.1.50808 WP_000355342.1.5088 WP_000355342.1.50908 WP_000355342.1.50941 WP_000355342.1.51014 WP_000355342.1.51022 WP_000355342.1.51179 WP_000355342.1.51182 WP_000355342.1.51186 WP_000355342.1.51487 WP_000355342.1.51488 WP_000355342.1.51634 WP_000355342.1.51649 WP_000355342.1.51686 WP_000355342.1.51756 WP_000355342.1.51911 WP_000355342.1.51932 WP_000355342.1.51989 WP_000355342.1.52121 WP_000355342.1.52346 WP_000355342.1.52353 WP_000355342.1.52361 WP_000355342.1.52653 WP_000355342.1.52743 WP_000355342.1.52857 WP_000355342.1.52898 WP_000355342.1.52915 WP_000355342.1.53190 WP_000355342.1.53406 WP_000355342.1.53466 WP_000355342.1.53529 WP_000355342.1.53543 WP_000355342.1.53757 WP_000355342.1.53812 WP_000355342.1.54033 WP_000355342.1.54075 WP_000355342.1.54196 WP_000355342.1.54209 WP_000355342.1.54271 WP_000355342.1.54274 WP_000355342.1.54319 WP_000355342.1.54364 WP_000355342.1.54400 WP_000355342.1.54644 WP_000355342.1.54662 WP_000355342.1.54722 WP_000355342.1.54749 WP_000355342.1.54764 WP_000355342.1.55008 WP_000355342.1.55152 WP_000355342.1.55156 WP_000355342.1.55285 WP_000355342.1.55475 WP_000355342.1.55647 WP_000355342.1.55743 WP_000355342.1.55768 WP_000355342.1.55782 WP_000355342.1.55796 WP_000355342.1.56002 WP_000355342.1.56012 WP_000355342.1.56105 WP_000355342.1.56238 WP_000355342.1.56286 WP_000355342.1.56304 WP_000355342.1.56414 WP_000355342.1.56438 WP_000355342.1.56560 WP_000355342.1.56601 WP_000355342.1.56614 WP_000355342.1.56671 WP_000355342.1.56682 WP_000355342.1.56875 WP_000355342.1.56877 WP_000355342.1.57168 WP_000355342.1.57187 WP_000355342.1.57377 WP_000355342.1.57418 WP_000355342.1.57515 WP_000355342.1.57529 WP_000355342.1.57576 WP_000355342.1.57601 WP_000355342.1.57607 WP_000355342.1.57763 WP_000355342.1.57862 WP_000355342.1.57890 WP_000355342.1.57891 WP_000355342.1.57978 WP_000355342.1.5801 WP_000355342.1.58041 WP_000355342.1.58418 WP_000355342.1.58548 WP_000355342.1.5858 WP_000355342.1.58662 WP_000355342.1.58669 WP_000355342.1.58745 WP_000355342.1.58803 WP_000355342.1.5886 WP_000355342.1.59094 WP_000355342.1.59224 WP_000355342.1.59321 WP_000355342.1.59375 WP_000355342.1.59458 WP_000355342.1.59490 WP_000355342.1.59508 WP_000355342.1.59684 WP_000355342.1.59694 WP_000355342.1.59771 WP_000355342.1.5979 WP_000355342.1.59953 WP_000355342.1.60008 WP_000355342.1.60021 WP_000355342.1.60069 WP_000355342.1.60140 WP_000355342.1.60155 WP_000355342.1.60285 WP_000355342.1.60379 WP_000355342.1.60464 WP_000355342.1.60874 WP_000355342.1.60941 WP_000355342.1.61078 WP_000355342.1.6114 WP_000355342.1.61232 WP_000355342.1.6129 WP_000355342.1.61296 WP_000355342.1.61345 WP_000355342.1.61417 WP_000355342.1.61574 WP_000355342.1.61712 WP_000355342.1.61714 WP_000355342.1.61730 WP_000355342.1.61857 WP_000355342.1.61918 WP_000355342.1.61952 WP_000355342.1.62007 WP_000355342.1.62025 WP_000355342.1.62204 WP_000355342.1.62304 WP_000355342.1.62364 WP_000355342.1.62374 WP_000355342.1.62403 WP_000355342.1.6253 WP_000355342.1.62853 WP_000355342.1.62903 WP_000355342.1.62910 WP_000355342.1.62955 WP_000355342.1.63181 WP_000355342.1.63203 WP_000355342.1.63256 WP_000355342.1.63290 WP_000355342.1.63382 WP_000355342.1.63432 WP_000355342.1.63461 WP_000355342.1.63479 WP_000355342.1.63577 WP_000355342.1.63664 WP_000355342.1.63718 WP_000355342.1.6375 WP_000355342.1.63757 WP_000355342.1.63834 WP_000355342.1.64046 WP_000355342.1.6423 WP_000355342.1.64244 WP_000355342.1.64403 WP_000355342.1.64649 WP_000355342.1.64702 WP_000355342.1.64757 WP_000355342.1.64781 WP_000355342.1.64831 WP_000355342.1.6489 WP_000355342.1.65018 WP_000355342.1.65028 WP_000355342.1.65171 WP_000355342.1.65248 WP_000355342.1.65474 WP_000355342.1.65633 WP_000355342.1.6565 WP_000355342.1.65696 WP_000355342.1.6575 WP_000355342.1.65782 WP_000355342.1.6630 WP_000355342.1.66314 WP_000355342.1.66358 WP_000355342.1.66362 WP_000355342.1.6638 WP_000355342.1.6640 WP_000355342.1.66698 WP_000355342.1.6680 WP_000355342.1.66834 WP_000355342.1.66901 WP_000355342.1.66962 WP_000355342.1.67037 WP_000355342.1.67045 WP_000355342.1.67181 WP_000355342.1.67268 WP_000355342.1.67347 WP_000355342.1.67465 WP_000355342.1.67552 WP_000355342.1.67682 WP_000355342.1.67829 WP_000355342.1.67887 WP_000355342.1.68073 WP_000355342.1.68201 WP_000355342.1.68206 WP_000355342.1.6827 WP_000355342.1.68275 WP_000355342.1.6849 WP_000355342.1.68547 WP_000355342.1.68589 WP_000355342.1.68655 WP_000355342.1.68656 WP_000355342.1.68778 WP_000355342.1.68787 WP_000355342.1.68894 WP_000355342.1.68928 WP_000355342.1.68975 WP_000355342.1.69006 WP_000355342.1.6913 WP_000355342.1.69146 WP_000355342.1.69255 WP_000355342.1.69397 WP_000355342.1.69564 WP_000355342.1.69644 WP_000355342.1.69704 WP_000355342.1.7021 WP_000355342.1.70241 WP_000355342.1.70269 WP_000355342.1.70289 WP_000355342.1.70447 WP_000355342.1.70485 WP_000355342.1.70643 WP_000355342.1.70683 WP_000355342.1.70883 WP_000355342.1.70922 WP_000355342.1.70948 WP_000355342.1.71116 WP_000355342.1.71146 WP_000355342.1.71165 WP_000355342.1.71188 WP_000355342.1.71243 WP_000355342.1.71306 WP_000355342.1.71337 WP_000355342.1.71378 WP_000355342.1.71401 WP_000355342.1.71702 WP_000355342.1.71750 WP_000355342.1.71845 WP_000355342.1.71881 WP_000355342.1.71908 WP_000355342.1.71952 WP_000355342.1.71973 WP_000355342.1.72105 WP_000355342.1.72203 WP_000355342.1.72376 WP_000355342.1.72594 WP_000355342.1.72871 WP_000355342.1.72975 WP_000355342.1.7315 WP_000355342.1.73200 WP_000355342.1.7334 WP_000355342.1.73377 WP_000355342.1.73481 WP_000355342.1.7356 WP_000355342.1.73581 WP_000355342.1.73617 WP_000355342.1.73753 WP_000355342.1.73758 WP_000355342.1.73794 WP_000355342.1.7387 WP_000355342.1.73924 WP_000355342.1.74029 WP_000355342.1.74181 WP_000355342.1.74191 WP_000355342.1.7433 WP_000355342.1.74379 WP_000355342.1.74410 WP_000355342.1.74466 WP_000355342.1.74529 WP_000355342.1.74545 WP_000355342.1.74745 WP_000355342.1.75129 WP_000355342.1.75187 WP_000355342.1.75288 WP_000355342.1.75334 WP_000355342.1.75362 WP_000355342.1.75385 WP_000355342.1.75392 WP_000355342.1.75760 WP_000355342.1.75764 WP_000355342.1.75874 WP_000355342.1.75945 WP_000355342.1.76020 WP_000355342.1.76252 WP_000355342.1.76445 WP_000355342.1.7660 WP_000355342.1.76673 WP_000355342.1.76706 WP_000355342.1.76721 WP_000355342.1.76756 WP_000355342.1.76760 WP_000355342.1.76875 WP_000355342.1.76880 WP_000355342.1.76899 WP_000355342.1.77038 WP_000355342.1.77047 WP_000355342.1.77080 WP_000355342.1.7712 WP_000355342.1.77180 WP_000355342.1.77244 WP_000355342.1.77292 WP_000355342.1.77514 WP_000355342.1.77529 WP_000355342.1.77549 WP_000355342.1.77692 WP_000355342.1.7782 WP_000355342.1.77851 WP_000355342.1.77898 WP_000355342.1.77918 WP_000355342.1.77960 WP_000355342.1.78033 WP_000355342.1.78076 WP_000355342.1.78096 WP_000355342.1.78100 WP_000355342.1.78110 WP_000355342.1.78120 WP_000355342.1.78383 WP_000355342.1.78407 WP_000355342.1.7861 WP_000355342.1.78618 WP_000355342.1.78673 WP_000355342.1.78735 WP_000355342.1.78802 WP_000355342.1.78830 WP_000355342.1.78835 WP_000355342.1.78871 WP_000355342.1.78874 WP_000355342.1.78918 WP_000355342.1.78930 WP_000355342.1.79151 WP_000355342.1.79167 WP_000355342.1.79335 WP_000355342.1.79462 WP_000355342.1.79472 WP_000355342.1.79490 WP_000355342.1.79529 WP_000355342.1.79570 WP_000355342.1.7964 WP_000355342.1.79659 WP_000355342.1.79668 WP_000355342.1.79708 WP_000355342.1.79845 WP_000355342.1.80077 WP_000355342.1.80137 WP_000355342.1.80182 WP_000355342.1.80296 WP_000355342.1.80366 WP_000355342.1.80780 WP_000355342.1.80831 WP_000355342.1.80850 WP_000355342.1.80881 WP_000355342.1.80939 WP_000355342.1.8096 WP_000355342.1.81037 WP_000355342.1.81069 WP_000355342.1.81149 WP_000355342.1.81175 WP_000355342.1.8119 WP_000355342.1.81193 WP_000355342.1.81354 WP_000355342.1.81425 WP_000355342.1.81750 WP_000355342.1.81785 WP_000355342.1.81902 WP_000355342.1.81974 WP_000355342.1.82337 WP_000355342.1.82479 WP_000355342.1.82503 WP_000355342.1.82515 WP_000355342.1.82676 WP_000355342.1.82761 WP_000355342.1.8282 WP_000355342.1.82944 WP_000355342.1.82956 WP_000355342.1.83092 WP_000355342.1.83163 WP_000355342.1.83305 WP_000355342.1.83413 WP_000355342.1.83491 WP_000355342.1.83523 WP_000355342.1.8354 WP_000355342.1.83721 WP_000355342.1.83760 WP_000355342.1.83995 WP_000355342.1.84103 WP_000355342.1.84283 WP_000355342.1.84392 WP_000355342.1.8441 WP_000355342.1.84532 WP_000355342.1.84554 WP_000355342.1.84659 WP_000355342.1.84899 WP_000355342.1.8497 WP_000355342.1.85040 WP_000355342.1.85134 WP_000355342.1.85178 WP_000355342.1.85180 WP_000355342.1.85190 WP_000355342.1.8533 WP_000355342.1.8545 WP_000355342.1.85481 WP_000355342.1.85483 WP_000355342.1.85541 WP_000355342.1.8556 WP_000355342.1.85615 WP_000355342.1.85617 WP_000355342.1.85663 WP_000355342.1.85671 WP_000355342.1.85672 WP_000355342.1.85777 WP_000355342.1.85886 WP_000355342.1.85900 WP_000355342.1.85904 WP_000355342.1.85976 WP_000355342.1.86306 WP_000355342.1.86356 WP_000355342.1.86450 WP_000355342.1.86469 WP_000355342.1.86580 WP_000355342.1.86588 WP_000355342.1.86661 WP_000355342.1.8672 WP_000355342.1.8678 WP_000355342.1.86810 WP_000355342.1.8684 WP_000355342.1.86895 WP_000355342.1.86906 WP_000355342.1.87095 WP_000355342.1.87323 WP_000355342.1.8736 WP_000355342.1.87460 WP_000355342.1.87552 WP_000355342.1.87779 WP_000355342.1.87945 WP_000355342.1.88019 WP_000355342.1.88073 WP_000355342.1.8809 WP_000355342.1.88291 WP_000355342.1.88293 WP_000355342.1.8837 WP_000355342.1.88393 WP_000355342.1.88703 WP_000355342.1.88792 WP_000355342.1.88902 WP_000355342.1.8891 WP_000355342.1.88981 WP_000355342.1.89008 WP_000355342.1.89116 WP_000355342.1.89138 WP_000355342.1.89304 WP_000355342.1.89512 WP_000355342.1.89527 WP_000355342.1.89570 WP_000355342.1.89604 WP_000355342.1.89622 WP_000355342.1.89659 WP_000355342.1.89902 WP_000355342.1.8996 WP_000355342.1.90097 WP_000355342.1.90252 WP_000355342.1.90417 WP_000355342.1.90453 WP_000355342.1.90458 WP_000355342.1.90557 WP_000355342.1.90585 WP_000355342.1.90641 WP_000355342.1.90734 WP_000355342.1.91003 WP_000355342.1.91069 WP_000355342.1.91278 WP_000355342.1.91512 WP_000355342.1.91564 WP_000355342.1.91628 WP_000355342.1.91655 WP_000355342.1.91724 WP_000355342.1.91732 WP_000355342.1.91788 WP_000355342.1.92013 WP_000355342.1.92093 WP_000355342.1.92108 WP_000355342.1.92183 WP_000355342.1.92208 WP_000355342.1.92268 WP_000355342.1.92310 WP_000355342.1.92443 WP_000355342.1.92482 WP_000355342.1.92531 WP_000355342.1.92669 WP_000355342.1.92671 WP_000355342.1.92738 WP_000355342.1.93086 WP_000355342.1.93101 WP_000355342.1.93136 WP_000355342.1.93365 WP_000355342.1.93543 WP_000355342.1.93650 WP_000355342.1.93656 WP_000355342.1.93662 WP_000355342.1.937 WP_000355342.1.93705 WP_000355342.1.93804 WP_000355342.1.9389 WP_000355342.1.93994 WP_000355342.1.94072 WP_000355342.1.94162 WP_000355342.1.94168 WP_000355342.1.94198 WP_000355342.1.9432 WP_000355342.1.94354 WP_000355342.1.94380 WP_000355342.1.94458 WP_000355342.1.94565 WP_000355342.1.94584 WP_000355342.1.94674 WP_000355342.1.94796 WP_000355342.1.94959 WP_000355342.1.95051 WP_000355342.1.95085 WP_000355342.1.95121 WP_000355342.1.95282 WP_000355342.1.95546 WP_000355342.1.95630 WP_000355342.1.95911 WP_000355342.1.96139 WP_000355342.1.96317 WP_000355342.1.96343 WP_000355342.1.9644 WP_000355342.1.96469 WP_000355342.1.96500 WP_000355342.1.96555 WP_000355342.1.96563 WP_000355342.1.96732 WP_000355342.1.96771 WP_000355342.1.97015 WP_000355342.1.97145 WP_000355342.1.97190 WP_000355342.1.97318 WP_000355342.1.97369 WP_000355342.1.97594 WP_000355342.1.97597 WP_000355342.1.97613 WP_000355342.1.97620 WP_000355342.1.97727 WP_000355342.1.97732 WP_000355342.1.97736 WP_000355342.1.9775 WP_000355342.1.97846 WP_000355342.1.98019 WP_000355342.1.98022 WP_000355342.1.98110 WP_000355342.1.98146 WP_000355342.1.98219 WP_000355342.1.9841 WP_000355342.1.98495 WP_000355342.1.98531 WP_000355342.1.98577 WP_000355342.1.98676 WP_000355342.1.98677 WP_000355342.1.98760 WP_000355342.1.98843 WP_000355342.1.9898 WP_000355342.1.99098 WP_000355342.1.99184 WP_000355342.1.99267 WP_000355342.1.99276 WP_000355342.1.99646 WP_000355342.1.99657 WP_000355342.1.99660 WP_000355342.1.99712 WP_000355342.1.99813 WP_000355342.1.99858 WP_000355342.1.99889 WP_000355342.1.99958 gi|549725181|ref|YP_008645371.1| ABAO01000016|CDS_2743-3411 AE006468|CDS_2673995-2674663 CP001363|CDS_2725547-2726215 FN424405|CDS_2698374-2699042 gi|378989914|ref|YP_005253078.1| gi|378451276|ref|YP_005238635.1| gi|16765854|ref|NP_461469.1| gi|378445951|ref|YP_005233583.1| gi|378985094|ref|YP_005248249.1| gi|378700435|ref|YP_005182392.1| gi|379701765|ref|YP_005243493.1| gi|550901958|ref|YP_008671050.1| 99287.STM2534 gi|526221046|ref|YP_008266777.1| gi|525837408|ref|YP_008254219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]