SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7LRD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7LRD0
Domain Number 1 Region: 145-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.34e-36
Family AadK C-terminal domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.14e-29
Family AadK N-terminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7LRD0
Sequence length 283
Comment (tr|A0A0F7LRD0|A0A0F7LRD0_PHOTE) Uncharacterized protein {ECO:0000313|EMBL:AKH64322.1} KW=Complete proteome OX=230089 OS=Photorhabdus temperata subsp. thracensis. GN=VY86_14340 OC=Morganellaceae; Photorhabdus.
Sequence
MEDPVILLEKILTFARNDPRIDTVIQTGSRARNTRVDKFSDLDIELIGSGTDELIGNNLW
LNPLGEVMVALHLANEKEGEPDWPTCLVVFSGGRKVDFTLASVERLKDMKQRGLDKLYQR
GYKILLDKAGLTNGLPEITHQLTKSHIPSSAEFNENLHEFWFEATQVPVYIARGDLWPAR
MRDNEMKESLLAMMEWYVSIKSDGKTDVWYNGHHLHEWLPEKFSKRIQGIFGSYGKEEAI
RALQETTELYTEISAEVAEMKGFEFDSELPGKVRKHIMQVIGR
Download sequence
Identical sequences A0A0F7LRD0
WP_046975443.1.12641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]