SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7RGJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7RGJ0
Domain Number 1 Region: 11-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.09e-17
Family SMI1/KNR4-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7RGJ0
Sequence length 138
Comment (tr|A0A0F7RGJ0|A0A0F7RGJ0_BACAN) Uncharacterized protein {ECO:0000313|EMBL:BAR78311.1} KW=Complete proteome OX=1392 OS=Bacillus anthracis. GN=BASH2_04904 OC=Bacillus cereus group.
Sequence
MWKNLILEIEKIEKSFNDKLNTPATDSEVQKLRERMKESFNVDLPSEYEEFLKNVNGLDF
NGLVFYGVDSYLLDTERDESICGLIETNDIWYENEFQKEHLFFGDSNIAWFCKSLSDGTY
LELDKPSGTVMNTYNEHI
Download sequence
Identical sequences A0A0F7RGJ0 Q81UF8
gi|30261048|ref|NP_843425.1| gi|386734748|ref|YP_006207929.1| gi|49183890|ref|YP_027142.1| gi|227816218|ref|YP_002816227.1| NP_843425.1.87267 WP_003168731.1.100214 WP_003168731.1.100595 WP_003168731.1.10208 WP_003168731.1.11676 WP_003168731.1.13115 WP_003168731.1.13820 WP_003168731.1.14721 WP_003168731.1.14855 WP_003168731.1.15460 WP_003168731.1.15569 WP_003168731.1.16170 WP_003168731.1.16997 WP_003168731.1.17146 WP_003168731.1.18976 WP_003168731.1.19258 WP_003168731.1.19435 WP_003168731.1.20390 WP_003168731.1.20680 WP_003168731.1.21021 WP_003168731.1.21258 WP_003168731.1.21776 WP_003168731.1.22865 WP_003168731.1.2419 WP_003168731.1.24334 WP_003168731.1.24556 WP_003168731.1.24608 WP_003168731.1.25716 WP_003168731.1.25752 WP_003168731.1.2618 WP_003168731.1.26665 WP_003168731.1.26721 WP_003168731.1.27644 WP_003168731.1.27987 WP_003168731.1.28427 WP_003168731.1.28729 WP_003168731.1.29101 WP_003168731.1.29787 WP_003168731.1.30110 WP_003168731.1.3236 WP_003168731.1.32576 WP_003168731.1.33338 WP_003168731.1.33367 WP_003168731.1.33740 WP_003168731.1.33876 WP_003168731.1.34646 WP_003168731.1.35684 WP_003168731.1.35886 WP_003168731.1.36305 WP_003168731.1.36763 WP_003168731.1.38036 WP_003168731.1.39781 WP_003168731.1.41165 WP_003168731.1.41675 WP_003168731.1.4439 WP_003168731.1.45305 WP_003168731.1.45533 WP_003168731.1.46236 WP_003168731.1.47145 WP_003168731.1.4763 WP_003168731.1.47798 WP_003168731.1.52794 WP_003168731.1.53137 WP_003168731.1.53493 WP_003168731.1.53683 WP_003168731.1.54117 WP_003168731.1.54189 WP_003168731.1.55811 WP_003168731.1.55958 WP_003168731.1.56042 WP_003168731.1.56176 WP_003168731.1.56270 WP_003168731.1.58160 WP_003168731.1.59095 WP_003168731.1.59310 WP_003168731.1.59575 WP_003168731.1.60402 WP_003168731.1.61213 WP_003168731.1.63560 WP_003168731.1.68607 WP_003168731.1.69203 WP_003168731.1.69822 WP_003168731.1.69894 WP_003168731.1.70065 WP_003168731.1.72704 WP_003168731.1.73325 WP_003168731.1.74226 WP_003168731.1.74538 WP_003168731.1.75499 WP_003168731.1.75870 WP_003168731.1.76125 WP_003168731.1.76783 WP_003168731.1.77668 WP_003168731.1.77824 WP_003168731.1.78644 WP_003168731.1.79315 WP_003168731.1.79584 WP_003168731.1.80695 WP_003168731.1.81799 WP_003168731.1.82289 WP_003168731.1.83951 WP_003168731.1.84045 WP_003168731.1.85689 WP_003168731.1.86119 WP_003168731.1.86140 WP_003168731.1.86288 WP_003168731.1.8698 WP_003168731.1.8825 WP_003168731.1.88641 WP_003168731.1.90791 WP_003168731.1.9186 WP_003168731.1.92686 WP_003168731.1.92831 WP_003168731.1.93271 WP_003168731.1.93927 WP_003168731.1.94237 WP_003168731.1.94322 WP_003168731.1.94784 WP_003168731.1.96934 WP_003168731.1.97781 WP_003168731.1.97861 WP_003168731.1.98216 WP_003168731.1.99445 WP_003168731.1.99485 YP_027142.1.16718 gi|47526206|ref|YP_017555.1| 198094.BA_0918 260799.BAS0866 261594.GBAA0918 568206.BAMEG_3645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]