SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7RLV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7RLV4
Domain Number 1 Region: 35-229
Classification Level Classification E-value
Superfamily Sortase 6.15e-45
Family Sortase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7RLV4
Sequence length 233
Comment (tr|A0A0F7RLV4|A0A0F7RLV4_BACAN) Putative cysteine protease ywpE {ECO:0000313|EMBL:BAR78533.1} KW=Complete proteome OX=1392 OS=Bacillus anthracis. GN=BASH2_05126 OC=Bacillus cereus group.
Sequence
MYIQQYYLIILYRVRFCKGKELYMNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQT
ENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKS
STEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYE
YAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK
Download sequence
Identical sequences A0A0F7RLV4 A0R9X0 Q81V16
NP_843215.3.87267 gi|118476369|ref|YP_893520.1| 198094.BA_0688 261594.GBAA0688 412694.BALH_0627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]