SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7RRY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7RRY6
Domain Number 1 Region: 427-476,527-576,644-677
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.44e-31
Family Regulator of G-protein signaling, RGS 0.0028
Further Details:      
 
Domain Number 2 Region: 229-345
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000117
Family DEP domain 0.046
Further Details:      
 
Domain Number 3 Region: 40-154
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000194
Family MukF N-terminal domain-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7RRY6
Sequence length 770
Comment (tr|A0A0F7RRY6|A0A0F7RRY6_9BASI) Uncharacterized protein {ECO:0000313|EMBL:CDR98595.1} OX=49012 OS=Sporisorium scitamineum. GN=SSCI02720.1 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Sporisorium.
Sequence
MAPTDSSGSLPGDLSTRTKQQTTSRMMKTTRRGRPFAKDTHDLFATLIVSLQLGTHRQYF
KTYHNSFTTDEAAENLSHLKFSQSNRAPDPNEPSRIVTTTTTTTFSMNRGMAKGICQHFM
DARLIENAGDATNPIFKDKGVYMLTPKGLHILERFITKNGINGDHLLKVFSSQPICMKLL
HLERRASDDELLINTPVLEVIFRRFVGRSPNYQSAPAAGAKADHTEAIIDRTLGIDMADI
QEKVKGHGLRTVKHTFNAMGALDWLCDFTTVCGKDEAAEIMAHFQRLDLISLVLDKSRRE
IEPYDDRDVTIRVEDERGDVTDGHFRCHSKTFYGVTEKGRQVARWDGAQSPSSGVGSPAK
TNSRRLADDAALGHQSRQSVPQASLEIGSRESQDSRLARKPSTKLRNERGSTPVGGSAAA
IGQGLHDSSSYSSRDSNTNRLKNILEEPALRSLFREFLRQNFCEENLSFWLDVQDFKRRF
HTTSSAVAVQTPAKDKGGVGRRLGRSVTGALAGNTKDKNDEDSQGLNAMERHQQDLVSMA
FVIYDTYLAPSSPCELNIDHNLRTELILYMNKILADAKISSLSSQTASPSVSTTQLGATL
TGSEAPHGHHNNEVASIEERKAAVVSKRLRIPLHASQLQVMVRLYERIQDHVFRLMATDS
VPRFIKDARFIQLVRSVEEYTEALEAGRIDPEQNAGPAVGRAVFEAMQLKSADMLAQNSN
DARPSVDSSSYRSSSSPQKPSSKAVPAVPSLATPTSQDHAASSTPSVHDP
Download sequence
Identical sequences A0A0F7RRY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]