SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7RXU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7RXU8
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.14e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00086
Further Details:      
 
Domain Number 2 Region: 79-168,195-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000036
Family Cold shock DNA-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7RXU8
Sequence length 246
Comment (tr|A0A0F7RXU8|A0A0F7RXU8_9BASI) Related to RPC25-DNA-direcred RNA polymerase III, 25 KD subunit {ECO:0000313|EMBL:CDU26383.1} OX=49012 OS=Sporisorium scitamineum. GN=SPSC_06577 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Sporisorium.
Sequence
MFVLADIQDTISVHPSAFGQPSLTSISDQINVKYANKILVDVGLCISLFDILSCSEGKVR
FGDGCLYHHVTFRLVVFRPFTQEVLTGNIKSSDESGIRITLGFFDDIYVPFHLIPKPCAF
DHQERAWFWLYEARTEQIAADPLLSQQDERMYLDTAEAVRFTVESDAFWDAEPGPGAAPG
TDSTAHHNHHTAKETRPHYSITASIAGSGLGLVSWWTGAEAAAAATEEYIEEKQLEGELM
QEEADR
Download sequence
Identical sequences A0A0F7RXU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]