SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7S899 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7S899
Domain Number 1 Region: 11-61,192-286
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.29e-24
Family Regulator of G-protein signaling, RGS 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7S899
Sequence length 400
Comment (tr|A0A0F7S899|A0A0F7S899_9BASI) Related to RAX1-Protein involved in determination of budding patterns {ECO:0000313|EMBL:CDU24495.1} OX=49012 OS=Sporisorium scitamineum. GN=SPSC_03996 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Sporisorium.
Sequence
MSEKRRPLSLQSSHTRQRLPTLAEVLARRTLPPVDLYCFYLYLQREAAEDALDFWLDVQQ
HENLCRAYFKDLRKSGKSVKEDWPQYYAEALERGSIYNKINGIHEQTNTARRAPEMSWDH
QSRVDSPEGNYSTISHTPSALPPAAAGASGAPLSAPRFPGDPDYLAQQTRAERKSILAKR
GSVAPTVISRSAAITRTDLIASAERIYARYLLPGSEKEIYLPAPLRINSFPISSSALPHP
QDAEQQQALARIPDMFHSQKEYVFRTMEADVFPRFLRAKAFGNLTPISVLVRLSLGLLAL
WAALATAFSFIFLDVDRAKRCWVILPFSVAVLLLMSHQYELDPILVLLSQSETTPFRLIR
IREPYVRRLLLQRSLSVLLLIALITAALTVLFVFVPGHRL
Download sequence
Identical sequences A0A0F7S899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]