SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7SND5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7SND5
Domain Number 1 Region: 53-225
Classification Level Classification E-value
Superfamily eIF4e-like 2.88e-45
Family Translation initiation factor eIF4e 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7SND5
Sequence length 254
Comment (tr|A0A0F7SND5|A0A0F7SND5_PHARH) Predicted mRNA cap-binding protein related to eIF-4E {ECO:0000313|EMBL:CED82886.1} OX=5421 OS=Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous). GN= OC=Tremellomycetes; Cystofilobasidiales; Mrakiaceae; Xanthophyllomyces.
Sequence
MSSRTNGTNTSSSSSSSKAPASSGKRTLSLSMSSAETQSVLSGVNNGSAAGSKDSKHPCR
ISWLFWYTHRQPGAKITTAAQYEDSIKKIGGFASIESFWTIYSHLNPPSSLPPVTDVLLF
ASSIRLPIWEEVPKGAKFTLRLRKGLADRLWEDLVLASVGDQFEEEDGVVGVVLSVRTGE
DVISVWTEKSHTDGGARVKETIYRILNLPPSTVVDYKLNSEPNHHTPHRHHSQRNGHLTR
EESEISPFARSREL
Download sequence
Identical sequences A0A0F7SND5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]