SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7SP47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7SP47
Domain Number 1 Region: 94-169
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.4e-31
Family Skp1 dimerisation domain-like 0.0000359
Further Details:      
 
Domain Number 2 Region: 12-76
Classification Level Classification E-value
Superfamily POZ domain 3.14e-20
Family BTB/POZ domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7SP47
Sequence length 172
Comment (tr|A0A0F7SP47|A0A0F7SP47_PHARH) S-phase kinase-associated protein 1a-like protein {ECO:0000313|EMBL:CED82499.1} OX=5421 OS=Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous). GN= OC=Tremellomycetes; Cystofilobasidiales; Mrakiaceae; Xanthophyllomyces.
Sequence
MSAKTKTEGESKKITLETADKEEFLVDKEVAERSIMLKNMLEDVGESDMAIPLPNVTANV
LKKVLEYCEHHRNDPLPTATDENTDENRRRVADIQDWDAKFISVDQEMLFEIILAANYLD
IKPLLDVGCKTVANMIKGKTPDEIRKLFNIQNDFTPEEEEQIKRENEWAEDR
Download sequence
Identical sequences A0A0F7SP47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]