SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7SYZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7SYZ0
Domain Number 1 Region: 445-487,518-564,623-651
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-27
Family Regulator of G-protein signaling, RGS 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7SYZ0
Sequence length 729
Comment (tr|A0A0F7SYZ0|A0A0F7SYZ0_PHARH) Winged helix-turn-helix DNA-binding domain {ECO:0000313|EMBL:CED85538.1} OX=5421 OS=Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous). GN= OC=Tremellomycetes; Cystofilobasidiales; Mrakiaceae; Xanthophyllomyces.
Sequence
MSRDPSMDMQASNHMMKNTKKGRPFIQDLHDLFSTLIVSLNLGTHRQFFKQYHNAFTTDG
ACQNLSSLKFTQSSRSADPKDPNRILTTTTTTTFTMTRELAKGMCQHFMDAHLIENAADP
SSSTFKDRGIYVCTPKGLHILERFVAKNGIAQQQRLKVFASQPICMKLLHLERKPSDDEL
CTSKVVVEMLWRRFAGRKPNRIDPSQLPSSYSPSSSPSSSASTPISNVRHTRQNPPSGQS
TDIFDQTHGAAFRKHQEKDKTGKLEVVPYAIGSFQVIGWLLDHTTMAHKEEAMEMAARFV
WLGFLELISERGKVNKDMATKTVVQGKEDGPVKSSGEFRASEKAIYKVTERGMQAARWPG
YGRDSVSHPLVTGSRSVDTEELTREERPSVNRVLFGRSITDQTPFRHSPSPHQVDQSELL
SHTDSAEIEPRSSPEGGGSSMFKESHTTKLQQILEEPSLRSLFREFLRSCFCEENLSYWL
DVQELRKRFSTTSSAAAAGHAQGQGQGKSKDAANSTMERHQQDLVAVALNIYNTYLAPHS
PSELNIDHNLRGDLVNYVSRNLLDQAAIASSNLPSTNATGMRALSSSPDSKPNATANSKR
ENDSIDPRAYQMDASNLQSLLTVYEQIQSYIFRLMATDSVPKFSKSDLFLSRGKPPVERK
VDYAIGKPILLGSAYSVNESADEEDIQARAYLTISQAAREKYTSSKRAAAAAAALSSSPS
TAPSLPSTV
Download sequence
Identical sequences A0A0F7SYZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]