SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7Z014 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7Z014
Domain Number 1 Region: 135-311
Classification Level Classification E-value
Superfamily Sec7 domain 3.14e-46
Family Sec7 domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 61-138
Classification Level Classification E-value
Superfamily F-box domain 5.63e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7Z014
Sequence length 318
Comment (tr|A0A0F7Z014|A0A0F7Z014_MICFL) F-box only protein 8-like protein {ECO:0000313|EMBL:JAI09995.1} OX=8637 OS=Micrurus fulvius (Eastern coral snake) (Coluber fulvius). GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MGQGLWRVARNQQLQQEYGGQSCLSRENGRRMTVNNVSNTNHRKHAQGGIDIYHLLKTRK
SKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSI
YNKNPPLGFSFRKLYMQLDEGSLTFNANPEEGVNYFMSKGILNDSPKEIAKFIFCTRTLN
WKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFKHIHAPEERGEYLETLITKFSHR
FCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNISE
DFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences A0A0F7Z014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]