SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7Z904 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7Z904
Domain Number 1 Region: 26-139
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.04e-30
Family Cystatins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7Z904
Sequence length 139
Comment (tr|A0A0F7Z904|A0A0F7Z904_CROAD) Cystatin {ECO:0000256|RuleBase:RU362130} OX=8729 OS=Crotalus adamanteus (Eastern diamondback rattlesnake). GN= OC=Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus.
Sequence
MHSRLPVPASLCLLLLLPSVLPASMPGGLSPRDVTDPEVQEAAVFAVEEYNARSTNSNYF
KALRLVQAESQVVSGAKYYLTMELVKTSCRKTNGNPKGYQEIQNCRLPPRNQQEKLTCHF
EVWSRPWLNKTLLTKVTCN
Download sequence
Identical sequences A0A0F7Z904 A0A0K8RWB9 J3RYX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]