SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7Z9B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7Z9B1
Domain Number 1 Region: 298-505
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-53
Family Eukaryotic proteases 0.000000353
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-31
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 213-299
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-28
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 40-83
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000206
Family Fibronectin type I module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7Z9B1
Sequence length 526
Comment (tr|A0A0F7Z9B1|A0A0F7Z9B1_CROAD) Plasminogen activator {ECO:0000256|PIRNR:PIRNR001145} OX=8729 OS=Crotalus adamanteus (Eastern diamondback rattlesnake). GN= OC=Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus.
Sequence
MGLRQTLLFFLLAGAITVLQCQELFVRVIHSGREGQLRRGRCRDLFTKQTYNQKESWLRR
VKGRTEYCQCENSGIFCHAVPVKGCIKPLCLHGGRCQQALYSPNLFICFCPPGFSGKFCE
IDTRAVCYQDIGDTYRGTWSTTESGAECVNWKTKALRFKRFHADRPDALLLGLGDHNYCR
NPDKSSKPWCHVLKKNMYVWEYCSITSCANQKHSCVLGRGTDYRGGHHQTASGVTCLRWD
SHILDKKVYNAFHPDAHQLGLSSHNYCRNPDNDTQPWCHTFKNGVTKWEHCDVPICSTCG
LRKHKVAEIQIKGGAYSYIESHPWQAGIFVTNRGAEGYQCGGILINSCWVLSAAHCFPKG
SIDPQRIKVVLGRTFRVKSSDTEQVFQVERYITHEKHNSRTLDNDIALLKLKEHSEKCAT
ETDSVRPVCLPEAGLQLPDWTECEVSGYGKHEMASPFHSERLKEGHVRLYPDSLCTSARL
AKRTVTENMLCAGDTRHLHDACQVTSKMLRITLWDRSEGPASSERR
Download sequence
Identical sequences A0A0F7Z9B1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]