SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7ZCW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7ZCW3
Domain Number 1 Region: 196-335
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.28e-55
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.00000999
Further Details:      
 
Domain Number 2 Region: 6-192
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.87e-53
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7ZCW3
Sequence length 351
Comment (tr|A0A0F7ZCW3|A0A0F7ZCW3_CROAD) 2'-5'-oligoadenylate synthetase 3 {ECO:0000313|EMBL:JAI14551.1} OX=8729 OS=Crotalus adamanteus (Eastern diamondback rattlesnake). GN= OC=Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus.
Sequence
MESLGYVKAEDLDNFHACYLQSNEDFLRKARRAINDICDFLKARCFQDAPWGGTRVLKVV
KGGSLGKGTSVRKGSDADLVLFLNIFKSYTDQEKNRKMIIQEMKRRLSECQKELYWEVDF
EPSLYANPRVLQFTLQSQETEDSIQFDVLPAYDALGQYHRSRPDPQIYVDLIRTGRCGEF
SPCFTELQKNFIVDRPTKLKNLIRLVKHWYKEVQEKSFPPKYALELLTVYVWEKGSGETK
FDMARGFRTVLWLIEKYKEIRIYWTTYYDFDNETIKRYLQTQLSKNSPVILDPADPTANV
GEGKRWDLLAKKAKTYASMKCCRNPDGSFVVPWNVPLAVEVPQEEGWCTLI
Download sequence
Identical sequences A0A0F7ZCW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]