SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8AIB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8AIB5
Domain Number 1 Region: 252-389
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-35
Family cAMP-binding domain 0.00000275
Further Details:      
 
Domain Number 2 Region: 117-248
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.07e-31
Family cAMP-binding domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 3-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000115
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8AIB5
Sequence length 397
Comment (tr|A0A0F8AIB5|A0A0F8AIB5_LARCR) cAMP-dependent protein kinase type II-alpha regulatory subunit {ECO:0000313|EMBL:KKF21753.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_03060 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MSAVEIPAGLRELLQGYTVEVLRRRPADLVEFAVQHFTRTLEVQRKDPKAKKRSARPARK
GVSFEAKPNKPNKDDEEEEEDIVKPTACKYNRRVSVCAEAYNPDDDDDDDAELRVVHPKT
DEQRRRLQDACRDILLFKTLEQEQFSEVLDAMFEVLVKPQEHIIDQGDDGDNFYVIEKGV
YDIFVQKDGVSVCVGKYDNKGSFGELALMYNTPRAATIVATQEGALWGLDRATFHRLIVK
NNAKKRRLYEAFIECVPLLKSLELSERMKIVDVLGARVFKDGERIIAQGEEADCFYIVES
GEVKIMIKSKTKAGQQDNTEVEVARCSRGQYFGELALVTNKPRAASVYAVGETKCLVIDI
QAFERLLGPCMDIMKRNISQYEDQLVALFGSSVDLKH
Download sequence
Identical sequences A0A0F8AIB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]