SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8ASS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8ASS1
Domain Number 1 Region: 168-484
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.79e-73
Family Protein kinases, catalytic subunit 0.0000021
Further Details:      
 
Domain Number 2 Region: 41-187
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.74e-27
Family Regulator of G-protein signaling, RGS 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8ASS1
Sequence length 552
Comment (tr|A0A0F8ASS1|A0A0F8ASS1_LARCR) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_11420 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MSKKTFNTSDLLGLDNLVANTSYLRAQNLDRSELRKLRLTLSLPKPKKSSELELAVGGKY
VSLCEQQPIGRKLFQQFLQSSNLQYVAAAEFLEELSHWSFAEDETKEEAKRSILAKFCQP
ESKSFLSYLTGEEAQRCKALSDKNFNEETINQIKEATRDFLRGKPFSEYLKSPFFYKFLQ
WKEYEKQKITRRYFYEFRTLGKGGFGEVCAVQVKHTGQMYACKKLDKRRLKKKCGERLAL
LEKQVLEKVDSLFIVNLAYAFDTKTHLCLVMDLMNGGDLRFHIYELGERGIRMDRVVYYT
AQITTGILHLHSLDIVYRDMKPENVLLDAKGQCRLSDLGLAVELPKGKTICQMAGTTGYM
APEILRQDNYNSSVDWWALGCSIYEMVAARLPFKDFREKVQNEEVTRRTLEEECKFEHKR
FDAPTKDIISRFLRKKAQHRLGSRGDDPRKNPFFKSINFLRLEAGLVEPPWVPKSNVVYA
MNMNTFRDSTEVENIKFNDKDEKFFKEFSTGAVSVKWQKEMIDSGLFDELNDPQQNGHSC
ETVETSRACIIL
Download sequence
Identical sequences A0A0F8ASS1
XP_010735741.2.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]