SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8AU87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8AU87
Domain Number 1 Region: 130-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-19
Family Nucleotide and nucleoside kinases 0.00054
Further Details:      
 
Domain Number 2 Region: 4-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8AU87
Sequence length 259
Comment (tr|A0A0F8AU87|A0A0F8AU87_LARCR) Adenylate kinase isoenzyme 5 {ECO:0000313|EMBL:KKF11320.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_04966 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MNTNDAKEYLARREIPQLFESLLTGLMYYRPDDPIDYLEGCLKKARELGGPDKVRWDTFV
GQEKKSLPPLNGGQSRRSLFRNVLPDSPNFPYRRYDRLPPISQFSIESDSDLSETAELIE
EYEVFDPSRPRPKVILVIGGPGSGKGTQCLKIAERYGFQYVSVGELLRKKMIHNATSNRK
WSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQISGFFN
DNNNINKSSGNYDEVYNPA
Download sequence
Identical sequences A0A0F8AU87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]