SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8B0L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8B0L6
Domain Number 1 Region: 213-344
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-43
Family Regulator of G-protein signaling, RGS 0.00000254
Further Details:      
 
Domain Number 2 Region: 14-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-24
Family DEP domain 0.0052
Further Details:      
 
Domain Number 3 Region: 154-203
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000235
Family Transducin (heterotrimeric G protein), gamma chain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8B0L6
Sequence length 400
Comment (tr|A0A0F8B0L6|A0A0F8B0L6_LARCR) Regulator of G-protein signaling 11 {ECO:0000313|EMBL:KKF19108.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_00899 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MTINTLAKGGWNREQMSCFRKMEKVIVSMQDPDMGMKMRNQRLLITVIPHAMTGRDIIDW
LIQKYNICDEEALHVGGMLVRYGYIYPLKEPRSLVLRPDESPYRFQERYSVLNKRINHTW
DFVVMQAREQLSDCILKFTLCVLTCVFFFYLCLQIETCKRALGRNRVKSSICLEGFVKYS
EQYLNHDPIMQGCLPSNPWISDDTAHWTMNAEVVPTPTRLRVERWSFSFMELLNDSMGKR
EFMTYLEKEFSAENLCFWQACEDIRHGESSRIIQKVEEIYKNFLAPGAARWVNIDSKTMD
KTLTGIRHPHRFVMDDAQMHIYFLMKKDSYPRYLKSDLYKNLLAKAIVPQESKKSVFPFM
RRQRHACPSPALVVTHATEEDGHAKGAGEAGTNSAAGSHA
Download sequence
Identical sequences A0A0F8B0L6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]