SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8BAH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8BAH1
Domain Number 1 Region: 61-191
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-40
Family Regulator of G-protein signaling, RGS 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8BAH1
Sequence length 200
Comment (tr|A0A0F8BAH1|A0A0F8BAH1_LARCR) Regulator of G-protein signaling 17 {ECO:0000313|EMBL:KKF29673.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_04340 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MRKRQAAHIEAPPQAPGQPRPNTCCLCWCGCCKCLWNEDRMERGDRQTCTKMDSIETAEE
HHPSLEEVLSWSRSFEMMLRSLEGREVFREFLRSEYSEDNLLFWLACEELKKETNPTVVE
EKSRIIYEDYVSILSPKEVSLDSRVREGINQTLTEPSNLMYEEAQFQIYTLMHRDSFPRF
LNSTVYRDLLANRRRTCLDT
Download sequence
Identical sequences A0A0F8BAH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]