SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8BJA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8BJA3
Domain Number 1 Region: 270-398
Classification Level Classification E-value
Superfamily ApaG-like 4.97e-39
Family ApaG-like 0.0003
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.46e-18
Family SMI1/KNR4-like 0.0092
Further Details:      
 
Domain Number 3 Region: 6-88
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000106
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8BJA3
Sequence length 449
Comment (tr|A0A0F8BJA3|A0A0F8BJA3_LARCR) F-box only protein 3 {ECO:0000313|EMBL:KKF10095.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_03487 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
LTMSSSAEFRMDQLPADPLLHVLSFLGFRDLGPHVRILACSLVSRRLNELCRHNPLWKRL
SCKHWLLTDADRLQSGVSWFCLFKQYYRDLGRYVQYYPVLKSAWEQLKSFLQLRCPRMIA
SLKEGATEVELNDIEAQIGCRLPDDYRCSYRIHNGQKLVIPGLMGSMSLSNHYRSEVLLD
VETAAGGFQQKKGMRRCLPLTFCFHTGLSQYMALQPAEGRRMFESFYPCPVRSCFVEWFT
GYVHNVVTGEYPIIRDQIFRYVHDKSCVATTGDITVSVSTSFLPELSSVHPPHFFFTYRI
RIEMSSSALPEAACQLDSRYWRITTSDGNVEEVQGPGVVGEFPVMTPGKVHEYASCTTFS
TPSEYMEGHYTFHRLANKEEVFQVAIPRFHMVCPPFREPLVRTQRASTSYVPRFDDHDDD
GEYWDGDGDDFGDLRQSDVAAGAWCPRHI
Download sequence
Identical sequences A0A0F8BJA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]