SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8BJJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8BJJ4
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.1e-70
Family Crystallins/Ca-binding development proteins 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8BJJ4
Sequence length 176
Comment (tr|A0A0F8BJJ4|A0A0F8BJJ4_LARCR) Gamma-crystallin M3 {ECO:0000313|EMBL:KKF10385.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_12861 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MGKIIFYEDRNFQGRSWECMSDCSDFSSYLSRCHSFRVESGCFMAYDRPNYMGNQYFMRR
GDYADYMSMWGWSDYIKSCRMIPQHRGQFRIRIYERENFQGQSHELMDDCDNFQERYRMS
DCQSCNVMDGHWLMYEQPHYRGRMMYFRPGEYRNFMNMGWSGSRFMSMRRITDSCY
Download sequence
Identical sequences A0A0F8BJJ4
XP_019110161.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]