SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8C045 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8C045
Domain Number 1 Region: 162-283
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-33
Family cAMP-binding domain 0.000000855
Further Details:      
 
Domain Number 2 Region: 291-415
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-31
Family cAMP-binding domain 0.000000636
Further Details:      
 
Domain Number 3 Region: 58-106
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.66e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8C045
Sequence length 424
Comment (tr|A0A0F8C045|A0A0F8C045_LARCR) cAMP-dependent protein kinase type I-alpha regulatory subunit {ECO:0000313|EMBL:KKF21674.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_02201 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MFSCTACFYCESIRAEVAVLRFQEEKQAGHTSFRIWRSLPGHKTNMASSSTSSEEERSLR
ECEQYVQKHNVQQLLKDCIIQLCTARPDRPMAFLRDYFERLEKEEAQQMASQHKSSMRSD
SREDEVSPPMNPVVRGRSRRGAISAEVYTEEDAASYVRKVIPKDYKSMAALSKAMEKNVL
FAHLDDNERSDIFDAMFSVNYIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWVTSIGEG
GSFGELALIYGTPRAASVRAKSDVKLWGIDRESYRRILMGSTLRKRKMYEEFLSKVSILE
SLDKWERLTVADALETVQFEDGQKIVVQGQPGDEFFIILEGTAAVLQRRSEDEEFVEVGR
LGPSDYFGEIALLMNRPRAATVVSCGPLKCVKLDRPRFERVLGPCSDILKRNIEQYNSFV
SLSV
Download sequence
Identical sequences A0A0F8C045
XP_019123793.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]