SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8CB02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8CB02
Domain Number 1 Region: 23-73
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000942
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8CB02
Sequence length 293
Comment (tr|A0A0F8CB02|A0A0F8CB02_LARCR) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|EMBL:KKF15544.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_09346 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MEEIKDSLVFKGVAERLTLGITRILENMPGVVDVRFVERDPAEKRSLLSWEQKNTCILPE
DLRDFYLTTDGFTLTWSVKLDSECVPLGCMMINSVARLSPLLQPVSLFSLPNAPSLVDLD
WEENSTEIGTGHAPAAPHFDSRSRIFELDSCGGNGKVCLVYKNCTAGVVAQQSEIWFLDR
SLCWHFLTTTFSSYYRLMITHLGLPEWQYGFTPYGPSPQSKQWASLYQPLTFSCEHSLAD
PAGDSHLNKLDPTKAFKGKAKVPAPKKKQSAQCSLGSTAKNQGSTGRHIGAKR
Download sequence
Identical sequences A0A0F8CB02
XP_010731807.2.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]