SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8CE37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8CE37
Domain Number 1 Region: 43-175
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.41e-47
Family Regulator of G-protein signaling, RGS 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8CE37
Sequence length 181
Comment (tr|A0A0F8CE37|A0A0F8CE37_LARCR) Regulator of G-protein signaling 1 {ECO:0000313|EMBL:KKF17209.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_04450 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MPSLVASQPRELQHFNMDTDSKKKDRGGNLKSRLRSSQAFNTEGLSFEEMSQWSQSLERL
LSSKYGMKIFQAFLKSEFSDENIEFWLMCEDYKKIKSSFRMSSKAKKIFKRYIQAEAARE
INIDHKTRDSIRRNIKAPTTVCFDDAQRIVYGLMERDSYPRFLRSDIYQALLDSTSESVK
M
Download sequence
Identical sequences A0A0F8CE37
XP_010732048.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]