SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8CFA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8CFA8
Domain Number 1 Region: 5-66,111-249
Classification Level Classification E-value
Superfamily Proteasome activator 5.36e-78
Family Proteasome activator 0.00000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8CFA8
Sequence length 256
Comment (tr|A0A0F8CFA8|A0A0F8CFA8_LARCR) Proteasome activator complex subunit 3 {ECO:0000313|EMBL:KKF31402.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_07898 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MSSLLKVNSELKSKVETFREQITSEAEHLVSSFFPQKLLELDQFLKEPIFNVTDLKEIHS
EIKCKIPEPIVFTNSHDGVDMNTKKRKLEDGVTDESWQGGTRTLLMPEGMMKCNGKLVDL
IEQVKPEIRTLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVTELRTVESEAASYLDQ
ISRYYITRAKLVSKIAKYPHVEDYRRTVMEIDEKEYISLKIIVSELRNQYVTLHDMILKN
IEKIKKPRNSNAEALY
Download sequence
Identical sequences A0A0F8CFA8
XP_019112574.1.61708 XP_019129494.1.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]