SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8CQC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8CQC6
Domain Number 1 Region: 723-947
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-59
Family DBL homology domain (DH-domain) 0.000000149
Further Details:      
 
Domain Number 2 Region: 324-504
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.18e-46
Family Regulator of G-protein signaling, RGS 0.00000158
Further Details:      
 
Domain Number 3 Region: 947-1076
Classification Level Classification E-value
Superfamily PH domain-like 8.89e-29
Family Pleckstrin-homology domain (PH domain) 0.0000257
Further Details:      
 
Domain Number 4 Region: 46-127
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8CQC6
Sequence length 1276
Comment (tr|A0A0F8CQC6|A0A0F8CQC6_LARCR) Rho guanine nucleotide exchange factor 11 {ECO:0000313|EMBL:KKF24666.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_09294 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MSLRQPTSTLDRLSSLTIGDSERKSSASQQKEPNVDVFAESTGTGLVQRCVVVQKDQLGF
GFTVCGERVKLVQNVRPGGAAVKAGVHEGDRIIKVNGSLVSSMSHQEVVKLIKSGTYVAL
TLQGPPPSTTSLPLEPLQTDLTPNQRTSLGGEVPPPPPPPLPSGLSSTPSQRITGPKPLQ
DPEVQKHATQILRKMLEQEEAELQDLLEERLKNPSPSLEERIESAKRRAHQVRVKIQQDL
EGTRSEPVTSYVIAGEGRLSMDSSEGDFEAFESPRSSPSSSFRTPQHRRQNSDTHTPSDS
GGKAQIIGPEEEDEEDDGYAFNEMDGPFQDIELLKSRPAHMAVFMRYVFTQLLDPNPLLF
YLSVEAYLGSSPKDARALAPQICSHFLDPEAPLKIKVREEYLTDIESRLHAQEDIRGPLS
ELQQQVLPDIQDQIQDYRNKQMMGLGSLFGEGDLQQLDGDPVKERQVVDKQVTALWEILS
KHEEDRSSPLASAVLLYLRHSGIKLRDSKVFPGLSTEKEKWLAFLKTKKLSGTRKDKDGG
EDKKRNPILKYIGKPRSTSQSTFHVPLSPTEVRPGSVRNIIQQFENHTETGEEGGDAADP
QRLSSSSLGEDSMESPTVSVRLARSESLKAQGEGRRRGVVSGTESVPRSRSDVDMEDCGE
EREGPGLRPLQHSASSSASSSSARSLENPTPPYTPRSRRRSVDSPLALLPDAAALEEEVC
DSQNWQDTVPPQLLATLSPREVDRQAVIYELFTTEASHLRTLRVLDQVFFQKMRSVLNSD
ELACIFPNLPQVYELHASLCEAIKKRRETPIVQDIGDVMLARFEGAAGDEFQEQTSQLCS
QQSQALELIKNKQRKDPRFAHIIQECEASPHCRRLQLKDLLVSEMQRLTKYPLLLDKIMK
HTEAGSSDLPSLQRAQACCRGILQAVNEIVRETEHRQRLSQYQRRLDAAPQFKSLDFSTK
RMIHEGPLTWKVNKDKQIEIQALLLSDCLVLLQRGPDDRLQLRYPSRWLGGGGGGSGDSK
TSFSPLVKLDSLLVRSVATDNRALYIISTTERQIYELVAGTASEKNTWKELLEKTIASAD
GSSPLVNHGSMRISSPSLRSASPVSVSSSVYPDNSMTEQSDSMETHSSNDDIALSADTPS
DQSERKAAGVAEAALQDVETLRQLILRDLEDDCWSHDSDDTPTNETSNERGSFTERQRPE
SLETVLNFSTDEWEAEPEDVLLPPPPFFFCCCFFSVALGTRKLDRLTGISEGVSAQPRTS
TRARGGGSPGWNEEKV
Download sequence
Identical sequences A0A0F8CQC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]