SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8CVR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8CVR2
Domain Number 1 Region: 105-242
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-39
Family Regulator of G-protein signaling, RGS 0.000000575
Further Details:      
 
Domain Number 2 Region: 729-809
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-27
Family DIX domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8CVR2
Sequence length 809
Comment (tr|A0A0F8CVR2|A0A0F8CVR2_LARCR) Axin-1 {ECO:0000313|EMBL:KKF28676.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_03138 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MSVVRELHGIGYRGGGGGVVASLSGPTHFTEDAPRPPVPGEEGSDVDPPVQSASTRPNTL
SQTLGYLPLSSSSKMGDPSSYTPSSSSATPRRPDLDLGYEPEGSASPTPPYLKWAESLHS
LLDDQEGIQLFRNFLCQEGCADLLDFWFACSGFRKTSQEKRAKLAKAIYRKYIVDGSGIV
SRQIKAATKSFIRDCVGRPHPDPAMFEQAQTEIQGMMEENTYPLFLKSDLYLEYTRTGGE
SPKPNPSDQSPSSGPAKPVPGYLPTLAEDEEWRCGGGGGGMREVEEEKDEEECGDTPAGR
LTHSLLMQTAPQRATTNRRRQDSREYRPWREPVNPYYANMGYARAPATSANDSEQQSMSS
DADTLSLTDSSVDGIPPYRYRKQHRKEMHESAKANGRVPLPHIPRTYRMPKDIHVEPERF
AAELISRLETVLREREAQERLEERLKRVRLSPGATNSTLGGGGRHTPPKTSRSPDGGTGP
PHYPPHRGAGHSLPAAGVKGMHHHKQLYHHRGREGQEEAGSRSQANFMWNGDPANQYPGR
SRNYADGAGASTIEGMGYSSKGSTLSRRGCKKASETSGKGDESGRGVEAQVPLEDLERNQ
KILQWMMDGDRQRKSTHSSSTSSSRRMGASSESPRPTSVERPGAVHPWVSAQLRNNPSSV
STAIPGSSSTQVQPSHPFIQDPAMPPNPAPNPLTQLEEARRRLEEERRRNALQQAKQRHK
SGKRQVCENMTVAYYFCGEPIPYRTSVKGRVVTLGQFKELLTKKGHYRFYFKKVSDEFDC
GVVFEEVRDDDAILPIFEEKIIGKVEKVD
Download sequence
Identical sequences A0A0F8CVR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]