SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8DFQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8DFQ8
Domain Number 1 Region: 41-75,189-258
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000673
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8DFQ8
Sequence length 426
Comment (tr|A0A0F8DFQ8|A0A0F8DFQ8_CERFI) Uncharacterized protein {ECO:0000313|EMBL:KKF94809.1} KW=Complete proteome; Reference proteome OX=88771 OS=Ceratocystis fimbriata f. sp. platani. GN=CFO_g2843 OC=Ceratocystis.
Sequence
MQQESLRKLGERGERKYPDIASMSSPCQESLSFDRMVNGELQYPFTKREFLDYLIYIEGS
AENFQFWTWFSDYEARFNVAYSQLHLGLNSVYSGTTSISNTPELVSDDGCSGHTSEDGME
LRVQDTRKAIVSVVSNSSDPFATPPCTPGIKEFDATKNPPSIPYHQIIPKTSLRSLTPAE
AQTLSDPEHDDLRPFSEEKSRAVATYIIADSRRQLDISSQDRKSIITDDSAHPDIFKSTF
INADQALRKNSYPAFVRWSRPNCDPIRLHALKIMAVLVMLSSIAIALLLTLSHVHREWRL
LAVPGLFLGSMIILCAFRDVCVFLYVARLRHVRPWEQFLDEEMAQTKNKLSTTHFGPANA
FDDEVWVERSKSRNLWQKIFDKSVPIQEKGLIRVYDMIVLQSAGMAMLVSGAIAGILIAI
PPANLF
Download sequence
Identical sequences A0A0F8DFQ8 A0A2C5WYP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]