SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8E6H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8E6H4
Domain Number 1 Region: 3-77
Classification Level Classification E-value
Superfamily Pre-PUA domain 2.68e-21
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.0014
Further Details:      
 
Domain Number 2 Region: 80-152
Classification Level Classification E-value
Superfamily PUA domain-like 1.77e-16
Family PUA domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8E6H4
Sequence length 160
Comment (tr|A0A0F8E6H4|A0A0F8E6H4_9EURY) Pseudouridine synthase {ECO:0000313|EMBL:KKG10508.1} KW=Complete proteome OX=1483596 OS=Methanosarcina sp. 2.H.T.1A.15. GN=EO97_05235 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MNCNVERLSRVRMIADYQFGKGTGKELFPDGSTFQLSRTKRVRQVFHSGNRIATARAKDG
FFTLSIEGASIVHRLLPGKRLRVVVSEDAVPFVEAGKTAFAKHVIEIDTELRAGEEVLIT
DKADRLLATGQLLLSPAEILSLDSGAAVDVRVGTASKKEE
Download sequence
Identical sequences A0A0F8CXL5 A0A0F8D968 A0A0F8E6H4 A0A0F8FDU0
WP_048142618.1.35842 WP_048142618.1.60556 WP_048142618.1.68146 WP_048142618.1.72848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]