SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8G8C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F8G8C1
Domain Number - Region: 23-128
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.034
Family Pseudo ankyrin repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8G8C1
Sequence length 378
Comment (tr|A0A0F8G8C1|A0A0F8G8C1_METMZ) Uncharacterized protein {ECO:0000313|EMBL:KKG50979.1} KW=Complete proteome OX=2209 OS=Methanosarcina mazei (Methanosarcina frisia). GN=DU30_11570 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MIVRKNISIDQCYIDKLKPFLDKNNGNLSAAIRDSIETACQLIEEKNGEKGEKNSKDSNQ
ALRNAESRNRMIEEEEFLLIHHTMLEWFIRKTSGLLIEESTVYELINPYTIKKIPDFIDY
VNALNNRLGWKIKVDAECTGSPEPESVILTLSNGNPCFRGVIAHSLSLFLAKQMKLDLQG
LFSRSNVTKVYLRRFEFLDYEKIPKGLEEYFGPMESTFKEIRKRPEFWKNLIKIYREQNY
QRLSMNKKVFEAFVSGDLPSVDDIAREFELFTGKPPEAFTLSEHIMIFKALYLTDNIGTE
IEVCTEKGSEYVRLIHDYCDSKVCERVICYYSNIFKCIGHPFTVTSSPHMIVFEFGKNLN
NIRIPESRLISSEPSLTP
Download sequence
Identical sequences A0A0E3LGA0 A0A0E3S386 A0A0F8G8C1 M1QIP7
WP_015411806.1.12270 WP_015411806.1.13133 WP_015411806.1.14209 WP_015411806.1.14583 WP_015411806.1.14776 WP_015411806.1.15587 WP_015411806.1.16878 WP_015411806.1.18729 WP_015411806.1.18783 WP_015411806.1.21267 WP_015411806.1.21501 WP_015411806.1.2157 WP_015411806.1.21629 WP_015411806.1.21918 WP_015411806.1.24179 WP_015411806.1.29103 WP_015411806.1.29761 WP_015411806.1.32345 WP_015411806.1.33522 WP_015411806.1.41322 WP_015411806.1.43564 WP_015411806.1.43834 WP_015411806.1.44090 WP_015411806.1.4739 WP_015411806.1.4970 WP_015411806.1.53089 WP_015411806.1.53770 WP_015411806.1.57580 WP_015411806.1.58691 WP_015411806.1.61041 WP_015411806.1.61670 WP_015411806.1.62876 WP_015411806.1.63409 WP_015411806.1.64722 WP_015411806.1.65224 WP_015411806.1.66913 WP_015411806.1.7135 WP_015411806.1.7314 WP_015411806.1.73216 WP_015411806.1.73711 WP_015411806.1.74065 WP_015411806.1.75484 WP_015411806.1.75785 WP_015411806.1.76299 WP_015411806.1.7642 WP_015411806.1.76508 WP_015411806.1.8229 WP_015411806.1.82623 WP_015411806.1.83034 WP_015411806.1.8430 WP_015411806.1.84394 WP_015411806.1.9066 WP_015411806.1.90871 WP_015411806.1.91617 WP_015411806.1.94933 gi|452209997|ref|YP_007490111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]