SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8NJS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8NJS8
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 5.36e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00027
Further Details:      
 
Domain Number 2 Region: 80-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.88e-20
Family Cold shock DNA-binding domain-like 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8NJS8
Sequence length 195
Comment (tr|A0A0F8NJS8|A0A0F8NJS8_9EURY) DNA-directed RNA polymerase subunit E {ECO:0000313|EMBL:KKH50887.1} KW=Complete proteome OX=1483601 OS=Methanosarcina sp. 1.H.A.2.2. GN=EO93_07255 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MYKLMKLVDTVRIPPTLLGEEVMPTIKNALREKLEGQVDKKLGSLVTVYNIDEVGEGHIL
VGDGAVYYDVTFEAVMFIPELQEIIEGEVVEAVGFGVFIGMGPMDGLLHVSQITDDFISY
DAKNARLVTKTGGKSIAEGDHVRARIVAVSINEREPKESKIGLTMRQTALGKLQWLEEAR
RKKQPQEVTGERLPE
Download sequence
Identical sequences A0A0F8D005 A0A0F8D5U5 A0A0F8EVA6 A0A0F8EW25 A0A0F8NJS8 A0A0F8SGP1
WP_048132194.1.35842 WP_048132194.1.60556 WP_048132194.1.68146 WP_048132194.1.72848 WP_048132194.1.78801 WP_048132194.1.96639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]