SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8QCU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8QCU9
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.00000000000000144
Family Steroid-binding domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8QCU9
Sequence length 76
Comment (tr|A0A0F8QCU9|A0A0F8QCU9_METMZ) Cytochrome B5 {ECO:0000313|EMBL:KKH72673.1} KW=Complete proteome OX=2209 OS=Methanosarcina mazei (Methanosarcina frisia). GN=DU31_17275 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKEYTLEELSEFNGKNGKVYIAYDGQVYDVSDSYLWEDGTHQGLHESGEDLTEAMDEAPH
GPETFKDFPVVGTLKK
Download sequence
Identical sequences A0A0E3PVY8 A0A0F8QCU9
WP_048041697.1.13133 WP_048041697.1.14776 WP_048041697.1.15587 WP_048041697.1.21267 WP_048041697.1.21501 WP_048041697.1.24179 WP_048041697.1.32345 WP_048041697.1.4739 WP_048041697.1.53089 WP_048041697.1.57580 WP_048041697.1.58691 WP_048041697.1.64722 WP_048041697.1.7314 WP_048041697.1.73216 WP_048041697.1.82623 WP_048041697.1.83034 WP_048041697.1.8430 WP_048041697.1.9066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]