SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8UDU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8UDU9
Domain Number 1 Region: 74-230
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.7e-20
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00042
Further Details:      
 
Domain Number 2 Region: 439-551
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000471
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8UDU9
Sequence length 634
Comment (tr|A0A0F8UDU9|A0A0F8UDU9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KKK17728.1} KW=Complete proteome; Reference proteome OX=308745 OS=Aspergillus rambellii. GN=ARAM_005980 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAVGVRAENTTTSIGISAVVVKNVRSSAMDIDEERGGRVLGNSKGPRICSRESKQPEPFV
GRRKRLLISTDSGFVENVLPSLAQHPEVELRLITDEPSALLSGTNRVPHYMDTVDSKTFG
KETSARNWLKAKAAELCEWADMLLVAPVDAGTLGSMLSGLTSTLTLALLRGWMSKKPVLL
IPGMTVSEWQHPLTERQLREVHRSWPWISIISPVLWRYSAPEELIQLPWAGLKELHETIE
RTLSLSLSQGTTSLAHPTESPAQQVVVSSEKPSPANITSLASQMTLGPNALEKGSPLLPM
ELWLNIFEDQLHDWEIAKAVGIPTNLQVPKEWQSHLLKMSTPASLEYTILRGSFAAIKKR
IDSLPRWKPLSDLACHLIFKFSRTDILSYLTENHLDLLWTTSRLTNIPYRASAIYGNPKI
LTWWRDAPALPNKEYIADAMDGASRAGFINVLEWWRTSGLELRYTERALESASAEGRVAV
LDWWKSAADKAPAYRPLLLKVGKSVLLAAQSGRTASLAWWDASGIPYTHAESVARIASTH
GHVHVLDFWYRLKGTKMIFDCQVLVGPTKNGHDNVLEWWRRSGLRVEFKTCDIEEALEDA
DPVSGAEERVRRWWSLNGLNLGVGTSEWMKIKVL
Download sequence
Identical sequences A0A0F8UDU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]