SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8WCY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8WCY1
Domain Number 1 Region: 531-676
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-27
Family Regulator of G-protein signaling, RGS 0.00098
Further Details:      
 
Domain Number 2 Region: 393-507
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-21
Family DEP domain 0.012
Further Details:      
 
Domain Number 3 Region: 287-342
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000114
Family PadR-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8WCY1
Sequence length 722
Comment (tr|A0A0F8WCY1|A0A0F8WCY1_9EURO) Developmental regulator flbA {ECO:0000313|EMBL:KKK15715.1} KW=Complete proteome OX=138278 OS=Aspergillus ochraceoroseus. GN=AOCH_006568 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPTISSASLNQGSPPSSQLHYQPPSSHSSSSSAAAAVVPVPVSSSPVDFGLPTFTSASSL
ATSESPAFVATTFATLNTIPSFTTNTPSFPGSVIGSISRRNRRSFAALAREKTSSAFANF
SAIGTTGTAPLRSSASSGSLSKHSRKHSQLSASDAPGITPLTPPLSEGSGSSEQSSPPFE
PSSTVTEHPASTTERRRQTIQLAPSSEPRLEPTLSLPPAKMHQTSSRLLRMTEDDRPFTK
VGFYGLVLHFDGSDQQSGVAQVLPIKSNADPKDPSRIVTTTTTTTFSMAKEMARSVCQRF
VDARFIESLDGKYSQIFPLKGALYQLTPKGINILQRFCQRNGITARHVIDVLESPRNTMQ
LVNLERDSETDKLSHDRATIEVIFRRFAGQDGPNVKNSISTSDSDSLSDYSNGLVGVKMA
KERKIGDKIFMNTFTGKAAVDWLMDCSTTIERRETVLIAELFVKYGLMITLQEDRSIPQP
ENLLVAFQPSKNAIYGVSERGQRVCGWIARDKTRDTTTYDNRGIPRDSNNARLNHILHDP
ALRLLFREFLRFSLCEENLSFYIDVSEFTTTYHKAEKVGHFKKPDAVRETLAAAYGLYNA
FLAPGSPCELNIDHALRNSLASRMTKAVGDDESMLKSLQEVVQLFEMAQTSVFKLMSSDS
VPKFLRDPKYSSVLQEHDVDLIGAPRAVLGILPKLNSTLSTRSIRFSPAAASCDAIRTLD
TT
Download sequence
Identical sequences A0A0F8WCY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]