SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8XSE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8XSE3
Domain Number 1 Region: 134-237
Classification Level Classification E-value
Superfamily GINS helical bundle-like 9.94e-22
Family PSF2 C-terminal domain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 10-68
Classification Level Classification E-value
Superfamily PriA/YqbF domain 7.85e-17
Family PSF2 N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8XSE3
Sequence length 269
Comment (tr|A0A0F8XSE3|A0A0F8XSE3_9EURO) DNA replication complex GINS protein PSF2 {ECO:0000256|PIRNR:PIRNR028998} KW=Complete proteome; Reference proteome OX=308745 OS=Aspergillus rambellii. GN=ARAM_000246 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAFPLQRGITPPEISFLAEMEMVSIVPRQRLEGLELLGGPVEPLIPPRRANIPLWLALLL
KRQRRANILPPPWLHPEYLTMILDIETQHHDYKDAFSPPMTLPGQPGLYDRDQRPVARPR
YTPEGQRYYPTPPFLPQNVAKEQESDQAPALPFHWLEVGTMLLDVASDDLVEPDQTRRLL
KELREVRTAKIRSGVEVLDSAATAGGGVALTGVGAMEIGEGRGFIVGVVDGLRRIGASKE
QAHREHMAEEMANGEYGATQDDEDDDMEF
Download sequence
Identical sequences A0A0F8UE44 A0A0F8XSE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]