SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8Z504 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8Z504
Domain Number 1 Region: 111-282
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.31e-43
Family MgtE membrane domain-like 0.0000516
Further Details:      
 
Domain Number 2 Region: 6-104
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-22
Family CBS-domain pair 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8Z504
Sequence length 285
Comment (tr|A0A0F8Z504|A0A0F8Z504_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKK61464.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_3014080 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
VDEVFFIYVVDDDDVLKGILSLKKLLLAGNTARIADLYKKDIISVRTDTKDEEVANIMEK
YDLVAIPVVDSIGRLMGRITIDDVVDVMREEAEKDYQMASGIVEDVEPSDNVVLLTRARI
PWLLIGLFGGIMAAIILGGYENELGLYPEMVFFIPLIAAMGGNVGVQSSAIIVQGLAANT
IGIESTGRKLFKELSVATINGTILSSLMLAYNLIMKEPLALTATVSISLFAVIIFASLFG
TFIPLILNRYKIDPALATGPFITTMNDIVGLAIYLMMGRLLYTLI
Download sequence
Identical sequences A0A0F8Z504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]