SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9JKX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9JKX3
Domain Number 1 Region: 5-163
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.31e-59
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F9JKX3
Sequence length 170
Comment (tr|A0A0F9JKX3|A0A0F9JKX3_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKL99617.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_1812650 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MPDKRIGIVMGSDSDLSTMQETLDVLNEFGVKYDVDVVSCHRSPHRAYQYAMGAEKKGYK
VIIGGAGGAAHLAGIIAALTPIPVIGVPMLTPDLGGLDSLYSTIQMPGGVPVAAVGIGKA
GAKNAAVLAIQILSISDKNLKKKVISYKKKLAEKVIQKDKNVKRKLKRRR
Download sequence
Identical sequences A0A0F9JKX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]