SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9VZ15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9VZ15
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-39
Family SMI1/KNR4-like 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F9VZ15
Sequence length 138
Comment (tr|A0A0F9VZ15|A0A0F9VZ15_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKO05278.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_0075490 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MEDVIELLRERNETIPVPLELPDEDLLVEIEEQVLMSLPDDFRDYLLEVSDVVFGSLEPV
TVTDPRSHTFLPEVAAQAWNDGMPRYLLPVCQLGDGYYCTNNEGEVRFWNGHKLGKDPQG
TKSWPSIWHWAREVWLQE
Download sequence
Identical sequences A0A0F9VZ15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]