SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9WK33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9WK33
Domain Number 1 Region: 71-191
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 8.83e-24
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.059
Further Details:      
 
Domain Number 2 Region: 7-62
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000316
Family Poly(A) polymerase, PAP, N-terminal domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F9WK33
Sequence length 193
Comment (tr|A0A0F9WK33|A0A0F9WK33_9MICR) Dna polymerase sigma {ECO:0000313|EMBL:KKO73533.1} KW=Complete proteome; Reference proteome OX=40302 OS=Nosema ceranae. GN=AAJ76_5790001 OC=Eukaryota; Fungi; Microsporidia; Nosematidae; Nosema.
Sequence
TDQNLVLKNIKHELYKTGLFTFINHLSHAKIPILKFTDKKYGLKFDISVNNNGGILAAQY
IKKKIEEDENIKILAILFKHFIYSRKLDDASVGGLNSYSQLLMIMNYLELHPFYSRNDKN
ISVVFFDFIQYYGFNFKYKNVQIDSASNIYKTNTTNRLSIIDPTDPIIDVGSCCKNMDKV
IETLQNFYRLILY
Download sequence
Identical sequences A0A0F9WK33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]